BLASTX nr result
ID: Cnidium21_contig00047297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00047297 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002329587.1| hypothetical protein POPTRDRAFT_264663 [Popu... 105 3e-21 ref|XP_002528779.1| Major pollen allergen Ory s 1 precursor, put... 104 8e-21 ref|XP_002326498.1| hypothetical protein POPTRDRAFT_423586 [Popu... 102 3e-20 ref|XP_002528780.1| Major pollen allergen Ory s 1 precursor, put... 102 4e-20 emb|CBI33924.3| unnamed protein product [Vitis vinifera] 98 6e-19 >ref|XP_002329587.1| hypothetical protein POPTRDRAFT_264663 [Populus trichocarpa] gi|222870296|gb|EEF07427.1| hypothetical protein POPTRDRAFT_264663 [Populus trichocarpa] Length = 232 Score = 105 bits (263), Expect = 3e-21 Identities = 45/64 (70%), Positives = 54/64 (84%) Frame = +1 Query: 1 KRFVCKLLSRTYGAVWTTTSPPTGALSISMLLSDDSGDETWVAAANNLPKHWKAGKTYDT 180 + FVCKLL R+YG+VWTTTSPP+G LS+ ML SD++GDETWV NN+P WKAG+TYDT Sbjct: 167 QNFVCKLLDRSYGSVWTTTSPPSGPLSLRMLFSDENGDETWVVPVNNIPNDWKAGETYDT 226 Query: 181 GVQV 192 GVQV Sbjct: 227 GVQV 230 >ref|XP_002528779.1| Major pollen allergen Ory s 1 precursor, putative [Ricinus communis] gi|223531782|gb|EEF33601.1| Major pollen allergen Ory s 1 precursor, putative [Ricinus communis] Length = 256 Score = 104 bits (259), Expect = 8e-21 Identities = 45/64 (70%), Positives = 53/64 (82%) Frame = +1 Query: 1 KRFVCKLLSRTYGAVWTTTSPPTGALSISMLLSDDSGDETWVAAANNLPKHWKAGKTYDT 180 + FVCKLL R+YGAVWTTTSPP+G LS+ ML S + GDETWV NN+P+ WKAG+TYDT Sbjct: 191 QNFVCKLLDRSYGAVWTTTSPPSGPLSLRMLFSGEDGDETWVVPVNNIPQDWKAGETYDT 250 Query: 181 GVQV 192 GVQV Sbjct: 251 GVQV 254 >ref|XP_002326498.1| hypothetical protein POPTRDRAFT_423586 [Populus trichocarpa] gi|222833820|gb|EEE72297.1| hypothetical protein POPTRDRAFT_423586 [Populus trichocarpa] Length = 230 Score = 102 bits (254), Expect = 3e-20 Identities = 43/64 (67%), Positives = 52/64 (81%) Frame = +1 Query: 1 KRFVCKLLSRTYGAVWTTTSPPTGALSISMLLSDDSGDETWVAAANNLPKHWKAGKTYDT 180 + F CK+L R+YGAVWTTTSPP+G LS+ ML S++ GDETWV NN+P WKAG+TYDT Sbjct: 167 QNFACKVLDRSYGAVWTTTSPPSGPLSLRMLFSEEDGDETWVVPVNNIPNDWKAGQTYDT 226 Query: 181 GVQV 192 GVQV Sbjct: 227 GVQV 230 >ref|XP_002528780.1| Major pollen allergen Ory s 1 precursor, putative [Ricinus communis] gi|223531783|gb|EEF33602.1| Major pollen allergen Ory s 1 precursor, putative [Ricinus communis] Length = 256 Score = 102 bits (253), Expect = 4e-20 Identities = 44/64 (68%), Positives = 52/64 (81%) Frame = +1 Query: 1 KRFVCKLLSRTYGAVWTTTSPPTGALSISMLLSDDSGDETWVAAANNLPKHWKAGKTYDT 180 + FVCKLL R+YGAVWTTTSPP+G LS+ ML S D G+ETWV N++P WKAG+TYDT Sbjct: 191 QNFVCKLLDRSYGAVWTTTSPPSGPLSLRMLFSGDDGEETWVVPVNDIPNDWKAGETYDT 250 Query: 181 GVQV 192 GVQV Sbjct: 251 GVQV 254 >emb|CBI33924.3| unnamed protein product [Vitis vinifera] Length = 238 Score = 98.2 bits (243), Expect = 6e-19 Identities = 42/64 (65%), Positives = 50/64 (78%) Frame = +1 Query: 1 KRFVCKLLSRTYGAVWTTTSPPTGALSISMLLSDDSGDETWVAAANNLPKHWKAGKTYDT 180 + FVCKLL R+YG+VWTT SPP+G LS+ ML S D GDETWV NN+P++WKA YDT Sbjct: 174 QNFVCKLLDRSYGSVWTTNSPPSGTLSLRMLFSGDDGDETWVVPINNIPENWKAADIYDT 233 Query: 181 GVQV 192 GVQV Sbjct: 234 GVQV 237