BLASTX nr result
ID: Cnidium21_contig00047265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00047265 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275658.1| PREDICTED: uncharacterized protein LOC100258... 105 4e-21 ref|XP_004136731.1| PREDICTED: uncharacterized protein LOC101202... 92 6e-17 ref|XP_003633597.1| PREDICTED: uncharacterized protein LOC100853... 89 4e-16 ref|XP_002317723.1| predicted protein [Populus trichocarpa] gi|2... 83 2e-14 ref|XP_002522096.1| protein binding protein, putative [Ricinus c... 81 1e-13 >ref|XP_002275658.1| PREDICTED: uncharacterized protein LOC100258837 [Vitis vinifera] Length = 252 Score = 105 bits (262), Expect = 4e-21 Identities = 39/77 (50%), Positives = 54/77 (70%) Frame = -2 Query: 270 CSEKTYVCWECNFFLDEECFHATRSIDHPCHPAHPLNLVPYPTYPSARFICDSCNQPGFG 91 CS Y CW+C+FFL EC +A R+++HP H H L LVPYPTY + F+C++C PG Sbjct: 32 CSNSAYACWKCDFFLHLECGNANRAMEHPSHELHHLTLVPYPTYSAGSFVCNACGAPGSS 91 Query: 90 FSFGCSKCDYDLHLHCS 40 FS+ CS C++DLH+ C+ Sbjct: 92 FSYCCSLCEFDLHIRCA 108 >ref|XP_004136731.1| PREDICTED: uncharacterized protein LOC101202742 [Cucumis sativus] gi|449511350|ref|XP_004163933.1| PREDICTED: uncharacterized LOC101202742 [Cucumis sativus] Length = 253 Score = 91.7 bits (226), Expect = 6e-17 Identities = 38/82 (46%), Positives = 46/82 (56%) Frame = -2 Query: 270 CSEKTYVCWECNFFLDEECFHATRSIDHPCHPAHPLNLVPYPTYPSARFICDSCNQPGFG 91 C Y C C FFL E C A RS+ HP HP+H L L+P PTYP F+C++C G Sbjct: 36 CHGLVYGCQSCEFFLHEACATAPRSLQHPSHPSHHLTLLPSPTYPDGSFLCNACGATGSS 95 Query: 90 FSFGCSKCDYDLHLHCSKINVQ 25 F F C CD DLH+ C + Q Sbjct: 96 FCFSCIPCDIDLHVDCGLLPQQ 117 >ref|XP_003633597.1| PREDICTED: uncharacterized protein LOC100853056 [Vitis vinifera] Length = 226 Score = 89.0 bits (219), Expect = 4e-16 Identities = 34/74 (45%), Positives = 47/74 (63%) Frame = -2 Query: 255 YVCWECNFFLDEECFHATRSIDHPCHPAHPLNLVPYPTYPSARFICDSCNQPGFGFSFGC 76 Y C C ++L + C + R I HP HP+H L L+P PTYPS F C++C FS C Sbjct: 38 YGCIACKYYLHDRCLNLPRWIKHPSHPSHSLTLLPAPTYPSGSFSCNACGSAANSFSKSC 97 Query: 75 SKCDYDLHLHCSKI 34 ++C++DLHLHCS + Sbjct: 98 AECEFDLHLHCSSL 111 >ref|XP_002317723.1| predicted protein [Populus trichocarpa] gi|222858396|gb|EEE95943.1| predicted protein [Populus trichocarpa] Length = 326 Score = 83.2 bits (204), Expect = 2e-14 Identities = 33/72 (45%), Positives = 40/72 (55%) Frame = -2 Query: 255 YVCWECNFFLDEECFHATRSIDHPCHPAHPLNLVPYPTYPSARFICDSCNQPGFGFSFGC 76 Y C CNF L C I HPCHP HPL L P YP F CD C G GF++ C Sbjct: 44 YSCKPCNFTLHISCTQMPTLITHPCHPIHPLTLFSTPVYPGGSFNCDGCGLQGNGFNYHC 103 Query: 75 SKCDYDLHLHCS 40 + CD+D+H+ C+ Sbjct: 104 TTCDFDVHMMCA 115 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 1/73 (1%) Frame = -2 Query: 255 YVCWECNFFLDEECFHATRSIDHPCHPAHPLNLVPYPTYPSARFICDSCNQPGFG-FSFG 79 Y C C+F + C S+ H HP H LNL YP Y + F CD C++ G + + Sbjct: 101 YHCTTCDFDVHMMCATNPLSLAHQSHP-HQLNLAFYPPYQTKGFSCDICHKIGSNHWLYR 159 Query: 78 CSKCDYDLHLHCS 40 CS C++D H+ C+ Sbjct: 160 CSACEFDAHMKCA 172 >ref|XP_002522096.1| protein binding protein, putative [Ricinus communis] gi|223538695|gb|EEF40296.1| protein binding protein, putative [Ricinus communis] Length = 240 Score = 80.9 bits (198), Expect = 1e-13 Identities = 31/79 (39%), Positives = 50/79 (63%), Gaps = 1/79 (1%) Frame = -2 Query: 267 SEKTYVCWECNFFLDEECFHATRSIDHPCHPAHPLNLVPYPTYPSARFICDSCNQP-GFG 91 +E ++ C C FL ++C + R + HP H +H L L+P PTYP + C++C P G Sbjct: 37 TEPSHGCLSCKHFLHDQCLNLPRWLQHPSHHSHTLTLLPAPTYPCGSYSCNACGIPGGSS 96 Query: 90 FSFGCSKCDYDLHLHCSKI 34 FSF C++C++DLH +C+ + Sbjct: 97 FSFSCAQCEFDLHTNCATL 115