BLASTX nr result
ID: Cnidium21_contig00047212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00047212 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003636982.1| Asparagine-linked glycosylation protein-like... 62 4e-08 tpg|DAA47263.1| TPA: alpha-1,2-mannosyltransferase alg11 [Zea mays] 62 5e-08 ref|XP_003578387.1| PREDICTED: GDP-Man:Man(3)GlcNAc(2)-PP-Dol al... 62 5e-08 ref|XP_002443441.1| hypothetical protein SORBIDRAFT_08g019540 [S... 62 5e-08 ref|NP_001142345.1| uncharacterized protein LOC100274516 precurs... 62 5e-08 >ref|XP_003636982.1| Asparagine-linked glycosylation protein-like protein [Medicago truncatula] gi|355502917|gb|AES84120.1| Asparagine-linked glycosylation protein-like protein [Medicago truncatula] Length = 432 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/61 (49%), Positives = 39/61 (63%) Frame = +3 Query: 99 LYSN*KLIKFNHFFFIFRLYVKAHT*PNDSVLLSHCKVIYYTIFSWLYGIVGSCAHLVMA 278 +Y+N ++ F +F L+ +SV LS CK++YYT FSWLYGIVGSCAHL M Sbjct: 126 MYNNDAVVAKRFDFHMFSLFYF------NSVWLSRCKIVYYTFFSWLYGIVGSCAHLAMV 179 Query: 279 N 281 N Sbjct: 180 N 180 >tpg|DAA47263.1| TPA: alpha-1,2-mannosyltransferase alg11 [Zea mays] Length = 460 Score = 62.0 bits (149), Expect = 5e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 186 SVLLSHCKVIYYTIFSWLYGIVGSCAHLVMAN 281 S+ LS CK++YYTIFSWLYG+VGSCAHLVM N Sbjct: 193 SIWLSRCKILYYTIFSWLYGLVGSCAHLVMVN 224 >ref|XP_003578387.1| PREDICTED: GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase-like [Brachypodium distachyon] Length = 472 Score = 62.0 bits (149), Expect = 5e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 186 SVLLSHCKVIYYTIFSWLYGIVGSCAHLVMAN 281 S+ LS CK++YYTIFSWLYG+VGSCAHLVM N Sbjct: 195 SIWLSRCKILYYTIFSWLYGLVGSCAHLVMVN 226 >ref|XP_002443441.1| hypothetical protein SORBIDRAFT_08g019540 [Sorghum bicolor] gi|241944134|gb|EES17279.1| hypothetical protein SORBIDRAFT_08g019540 [Sorghum bicolor] Length = 460 Score = 62.0 bits (149), Expect = 5e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 186 SVLLSHCKVIYYTIFSWLYGIVGSCAHLVMAN 281 S+ LS CK++YYTIFSWLYG+VGSCAHLVM N Sbjct: 193 SIWLSRCKILYYTIFSWLYGLVGSCAHLVMVN 224 >ref|NP_001142345.1| uncharacterized protein LOC100274516 precursor [Zea mays] gi|195608178|gb|ACG25919.1| alpha-1,2-mannosyltransferase alg11 [Zea mays] Length = 460 Score = 62.0 bits (149), Expect = 5e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 186 SVLLSHCKVIYYTIFSWLYGIVGSCAHLVMAN 281 S+ LS CK++YYTIFSWLYG+VGSCAHLVM N Sbjct: 193 SIWLSRCKILYYTIFSWLYGLVGSCAHLVMVN 224