BLASTX nr result
ID: Cnidium21_contig00047204
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00047204 (444 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272670.1| PREDICTED: uncharacterized protein LOC100241... 55 5e-06 >ref|XP_002272670.1| PREDICTED: uncharacterized protein LOC100241807 isoform 1 [Vitis vinifera] gi|298204943|emb|CBI34250.3| unnamed protein product [Vitis vinifera] Length = 69 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +3 Query: 15 FCRGFCNSICSCLYFFSCCWLLQDCLPGLGRPGHYSNPP 131 F GFC++I SCL F CCWLLQDC G G PG PP Sbjct: 30 FFGGFCDAISSCLNFLCCCWLLQDCFGGPGGPGGPGGPP 68