BLASTX nr result
ID: Cnidium21_contig00047163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00047163 (382 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37358.3| unnamed protein product [Vitis vinifera] 67 1e-09 ref|XP_003538743.1| PREDICTED: uncharacterized protein LOC100814... 64 2e-08 ref|XP_003516660.1| PREDICTED: uncharacterized protein LOC100792... 64 2e-08 emb|CAN83514.1| hypothetical protein VITISV_000825 [Vitis vinifera] 63 2e-08 ref|XP_002267137.2| PREDICTED: uncharacterized protein LOC100266... 63 3e-08 >emb|CBI37358.3| unnamed protein product [Vitis vinifera] Length = 1979 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -2 Query: 141 TPMDYDNDDTQDHSDWLSGEKSSKLSPVLRPYALPKFDFDDNLQAHL 1 TPMDYD++D Q + L+GE S+K PVL PYALPKFDFDD+LQ HL Sbjct: 46 TPMDYDDNDFQSQNLRLAGEGSAKFPPVLGPYALPKFDFDDSLQGHL 92 >ref|XP_003538743.1| PREDICTED: uncharacterized protein LOC100814320 [Glycine max] Length = 2009 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = -2 Query: 135 MDYDNDDTQDHSDWLSGEKSSKLSPVLRPYALPKFDFDDNLQAHL 1 MDYD++D Q+ + L+GE S+K PVLRPYALPKFDFD++LQA+L Sbjct: 1 MDYDDNDFQNQNLHLAGEGSAKFPPVLRPYALPKFDFDESLQANL 45 >ref|XP_003516660.1| PREDICTED: uncharacterized protein LOC100792428 [Glycine max] Length = 897 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = -2 Query: 135 MDYDNDDTQDHSDWLSGEKSSKLSPVLRPYALPKFDFDDNLQAHL 1 MDYD++D Q+ + L+GE S+K PVLRPYALPKFDFD++LQA+L Sbjct: 1 MDYDDNDFQNQNLHLAGEGSAKFPPVLRPYALPKFDFDESLQANL 45 >emb|CAN83514.1| hypothetical protein VITISV_000825 [Vitis vinifera] Length = 480 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -2 Query: 135 MDYDNDDTQDHSDWLSGEKSSKLSPVLRPYALPKFDFDDNLQAHL 1 MDYD++D Q + L+GE S+K PVL PYALPKFDFDD+LQ HL Sbjct: 1 MDYDDNDFQSQNLQLAGEGSAKFPPVLGPYALPKFDFDDSLQGHL 45 >ref|XP_002267137.2| PREDICTED: uncharacterized protein LOC100266068 [Vitis vinifera] Length = 2292 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -2 Query: 135 MDYDNDDTQDHSDWLSGEKSSKLSPVLRPYALPKFDFDDNLQAHL 1 MDYD++D Q + L+GE S+K PVL PYALPKFDFDD+LQ HL Sbjct: 1 MDYDDNDFQSQNLRLAGEGSAKFPPVLGPYALPKFDFDDSLQGHL 45