BLASTX nr result
ID: Cnidium21_contig00047146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00047146 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264214.1| PREDICTED: uncharacterized protein LOC100262... 64 1e-08 ref|XP_002512311.1| Ubiquitin-protein ligase BRE1A, putative [Ri... 59 4e-07 >ref|XP_002264214.1| PREDICTED: uncharacterized protein LOC100262311 [Vitis vinifera] gi|298205014|emb|CBI34321.3| unnamed protein product [Vitis vinifera] Length = 613 Score = 63.9 bits (154), Expect = 1e-08 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = +2 Query: 113 THQSNEVSEKIESLKSLNSMLLKETVERRQQVDSLKESNGLLESELKRVEMEK 271 T + SEK+++LKSLNS+LLKET ERRQQV+SL++S LESEL R MEK Sbjct: 24 TTPMEDPSEKLQNLKSLNSLLLKETFERRQQVESLQQSREALESELSRFAMEK 76 >ref|XP_002512311.1| Ubiquitin-protein ligase BRE1A, putative [Ricinus communis] gi|223548272|gb|EEF49763.1| Ubiquitin-protein ligase BRE1A, putative [Ricinus communis] Length = 622 Score = 58.9 bits (141), Expect = 4e-07 Identities = 34/66 (51%), Positives = 49/66 (74%), Gaps = 3/66 (4%) Frame = +2 Query: 137 EKIESLKSLNSMLLKETVERRQQVDSLKESNGLLESELKRVEMEKNEM---LGKVSECDL 307 +K+++LKSLN+MLLKET+ERRQQV+SL E+ +LES+L + EK ++ L VSE + Sbjct: 38 DKLQNLKSLNAMLLKETLERRQQVESLTEAKKVLESQLGLIGKEKMDLENELSVVSEERV 97 Query: 308 VGEIER 325 EIE+ Sbjct: 98 SLEIEK 103