BLASTX nr result
ID: Cnidium21_contig00047026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00047026 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACY01934.1| hypothetical protein [Beta vulgaris] 65 6e-09 gb|ABD63156.1| Retrotransposon gag protein [Asparagus officinalis] 61 1e-07 gb|ABG37658.1| integrase [Populus trichocarpa] 60 2e-07 >gb|ACY01934.1| hypothetical protein [Beta vulgaris] Length = 1717 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/60 (51%), Positives = 34/60 (56%), Gaps = 2/60 (3%) Frame = +3 Query: 6 VCEVCGIQGHYGNDCQYNAQNSQNFQMEQANVFQQ--RQQYNPYSNTYNPGWRDHPNFSY 179 VC+ CGI GH +C N E N FQ R Q+NPYSNTYNPG R HPN SY Sbjct: 270 VCDACGISGHNSQECPALGNNC-----EAVNAFQSQPRNQFNPYSNTYNPGLRQHPNLSY 324 >gb|ABD63156.1| Retrotransposon gag protein [Asparagus officinalis] Length = 275 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 2/59 (3%) Frame = +3 Query: 9 CEVCGIQGHYGNDCQYNAQNSQNFQM-EQANVFQQ-RQQYNPYSNTYNPGWRDHPNFSY 179 CE+CGI GH +CQ S + + E N Q+ +P+SNTYNPGWR+HPN SY Sbjct: 189 CEICGIIGHSAVECQIGNSPSPDAPLSEHVNYMNNFNQKGDPFSNTYNPGWRNHPNLSY 247 >gb|ABG37658.1| integrase [Populus trichocarpa] Length = 1139 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/60 (46%), Positives = 36/60 (60%), Gaps = 2/60 (3%) Frame = +3 Query: 6 VCEVCGIQGHYGNDCQYNAQNSQNFQMEQANVFQ--QRQQYNPYSNTYNPGWRDHPNFSY 179 VC++C H NDC + + EQA+ QR +NPYS TYNPGWR+HPNFS+ Sbjct: 91 VCQICETNEHSTNDCP-TLPSFKECLHEQAHALNNFQRPNHNPYSQTYNPGWRNHPNFSW 149