BLASTX nr result
ID: Cnidium21_contig00046811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00046811 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75463.1| hypothetical protein VITISV_006517 [Vitis vinifera] 60 1e-07 >emb|CAN75463.1| hypothetical protein VITISV_006517 [Vitis vinifera] Length = 337 Score = 60.5 bits (145), Expect = 1e-07 Identities = 34/63 (53%), Positives = 42/63 (66%) Frame = +1 Query: 190 RTN*FLSSTYIVGVLNLFLSILPRLLMM*LLVTFFYQERWPSTLVILITPPPIDEAGRLE 369 RTN FL+ +V VL F S L + LL+ Q+RWP+TLV+LITPPPIDE GRL Sbjct: 100 RTNTFLTCK-LVSVLLRFPSTLSVSHYLTLLICXELQKRWPTTLVLLITPPPIDEEGRLR 158 Query: 370 NPF 378 NP+ Sbjct: 159 NPY 161