BLASTX nr result
ID: Cnidium21_contig00046756
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00046756 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36557.3| unnamed protein product [Vitis vinifera] 55 6e-06 >emb|CBI36557.3| unnamed protein product [Vitis vinifera] Length = 372 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = -3 Query: 193 EDEILLLNSIQEQLNSIQYEIRSLKPKKHA-PQDDLSMASLKEAMLHFWL 47 E+E+ LL I E+LN IQ EI SL+PKK + P DD ++ SL EAML FWL Sbjct: 323 EEELKLLREIHEKLNLIQSEIESLRPKKRSPPPDDPALVSLMEAMLCFWL 372