BLASTX nr result
ID: Cnidium21_contig00046679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00046679 (456 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275952.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-18 ref|XP_002525469.1| pentatricopeptide repeat-containing protein,... 88 8e-16 ref|XP_002319140.1| predicted protein [Populus trichocarpa] gi|2... 87 1e-15 ref|XP_002319139.1| predicted protein [Populus trichocarpa] gi|2... 86 3e-15 ref|XP_003624580.1| Pentatricopeptide repeat-containing protein ... 82 3e-14 >ref|XP_002275952.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Vitis vinifera] Length = 566 Score = 95.5 bits (236), Expect = 4e-18 Identities = 42/80 (52%), Positives = 58/80 (72%) Frame = +1 Query: 4 EMKEKHLVPEPKIDEMLQTWVAGKQNADKQTVESKHGQVSRSQIAKETKVPSEKVERNVD 183 EMKEK +PEPK ++MLQ W++GK+ AD + ++ K Q Q +K+T V S+ V+ D Sbjct: 487 EMKEKQFLPEPKTEDMLQAWISGKETADVRMIDLKDNQSDHGQSSKKTLVTSKNVDLGRD 546 Query: 184 FRRQPETRKVVRERGYSFWD 243 FR+QPETRKV RERG+SFW+ Sbjct: 547 FRQQPETRKVTRERGFSFWE 566 >ref|XP_002525469.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535282|gb|EEF36959.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 581 Score = 87.8 bits (216), Expect = 8e-16 Identities = 39/79 (49%), Positives = 57/79 (72%) Frame = +1 Query: 4 EMKEKHLVPEPKIDEMLQTWVAGKQNADKQTVESKHGQVSRSQIAKETKVPSEKVERNVD 183 +MKEK L+P+PK+DEMLQTW++ KQ A+ Q ESK Q+ S++ + + S+++ D Sbjct: 501 DMKEKQLLPDPKLDEMLQTWLSNKQVAECQMTESKVDQLDCSRLGNQRRATSKRINHEKD 560 Query: 184 FRRQPETRKVVRERGYSFW 240 F +Q E R+VVRERG+SFW Sbjct: 561 FLQQAEIRRVVRERGFSFW 579 >ref|XP_002319140.1| predicted protein [Populus trichocarpa] gi|222857516|gb|EEE95063.1| predicted protein [Populus trichocarpa] Length = 296 Score = 87.4 bits (215), Expect = 1e-15 Identities = 49/91 (53%), Positives = 61/91 (67%), Gaps = 11/91 (12%) Frame = +1 Query: 4 EMKEKHLVPEPKIDEMLQTWVAGKQNADKQTVES----------KHGQVSRSQIAKETK- 150 EMKEK L+PEPKIDEMLQTW++ KQ A+ QT ES + Q+ SQ ++T+ Sbjct: 207 EMKEKQLLPEPKIDEMLQTWLSNKQIAEGQTTESRSNQCQTTELRSNQLDCSQSREQTRD 266 Query: 151 VPSEKVERNVDFRRQPETRKVVRERGYSFWD 243 +P ERN F RQ ETRKVVRERG+SFW+ Sbjct: 267 IPKRSHERN--FIRQAETRKVVRERGFSFWE 295 >ref|XP_002319139.1| predicted protein [Populus trichocarpa] gi|222857515|gb|EEE95062.1| predicted protein [Populus trichocarpa] Length = 518 Score = 85.9 bits (211), Expect = 3e-15 Identities = 49/91 (53%), Positives = 60/91 (65%), Gaps = 11/91 (12%) Frame = +1 Query: 4 EMKEKHLVPEPKIDEMLQTWVAGKQNADKQTVES----------KHGQVSRSQIAKETK- 150 EMKEK L+PEPKIDEMLQTW++ KQ A+ QT ES + Q+ SQ ++T+ Sbjct: 429 EMKEKQLLPEPKIDEMLQTWLSNKQIAEGQTTESRSNQCQTTELRSNQLDCSQSREQTRG 488 Query: 151 VPSEKVERNVDFRRQPETRKVVRERGYSFWD 243 +P ERN F RQ ETRKVVRERG SFW+ Sbjct: 489 IPKRSHERN--FIRQAETRKVVRERGISFWE 517 >ref|XP_003624580.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355499595|gb|AES80798.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 585 Score = 82.4 bits (202), Expect = 3e-14 Identities = 36/80 (45%), Positives = 50/80 (62%) Frame = +1 Query: 4 EMKEKHLVPEPKIDEMLQTWVAGKQNADKQTVESKHGQVSRSQIAKETKVPSEKVERNVD 183 EM+EK +PEPK + MLQ W++G+Q D Q + +H Q+ + K K K +R D Sbjct: 505 EMQEKGFLPEPKTESMLQAWLSGRQVTDSQATDLEHNQLEHGGLKKSVKPIQSKFDREKD 564 Query: 184 FRRQPETRKVVRERGYSFWD 243 F R+PETR V RE G+SFW+ Sbjct: 565 FLREPETRSVSREGGFSFWE 584