BLASTX nr result
ID: Cnidium21_contig00046635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00046635 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002449719.1| hypothetical protein SORBIDRAFT_05g022040 [S... 55 6e-06 >ref|XP_002449719.1| hypothetical protein SORBIDRAFT_05g022040 [Sorghum bicolor] gi|241935562|gb|EES08707.1| hypothetical protein SORBIDRAFT_05g022040 [Sorghum bicolor] Length = 210 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/55 (41%), Positives = 36/55 (65%) Frame = -2 Query: 332 LCNCSKRARVRTSWTTKNPGRRFLTCAKAKEEDGCNFFVWMDDGLTGRAKKIIFE 168 LCNC +A SW+T NPG R+L CA+A+ + GC+FF W+D + K+++ + Sbjct: 42 LCNCGAKAARFISWSTLNPGLRYLKCARAR-DGGCDFFRWVDQPTSAFLKQLLLD 95