BLASTX nr result
ID: Cnidium21_contig00045965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00045965 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291825.1| orf57 gene product (mitochondrion) [Daucus c... 62 4e-19 >ref|YP_006291825.1| orf57 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374082010|gb|AEY81202.1| orf57 (mitochondrion) [Daucus carota subsp. sativus] Length = 122 Score = 61.6 bits (148), Expect(2) = 4e-19 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 286 YSSRQIQEFSNRISFNFSLANQEADNKIWLYWNLQVH 176 + + +IQEFSNRI FNFSLANQEAD+KIWL WN +VH Sbjct: 40 HHANKIQEFSNRIRFNFSLANQEADDKIWLCWNHEVH 76 Score = 57.8 bits (138), Expect(2) = 4e-19 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 177 IVPVDTFEQCITIDICFLDSDLVRPTILYAKCSIQR 70 +V VD FEQCIT+DI FL+SD VR T+LYAKCSIQR Sbjct: 77 VVLVDAFEQCITVDIGFLNSDRVRLTVLYAKCSIQR 112