BLASTX nr result
ID: Cnidium21_contig00045740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00045740 (609 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACA10611.1| RNA polymerase C [Tapinanthus sp. OM 825] 59 7e-07 ref|YP_002456478.1| RNA polymerase beta [Trifolium subterraneum]... 58 2e-06 gb|ADT63246.1| RNA polymerase beta subunit [Juncus dudleyi] 57 3e-06 gb|ADD47681.1| RNA polymerase C [Juncus effusus] gi|290584874|gb... 57 3e-06 gb|ABU79850.1| RNA polymerase C [Amorphophallus titanum] 57 3e-06 >gb|ACA10611.1| RNA polymerase C [Tapinanthus sp. OM 825] Length = 160 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -1 Query: 315 SIIGKQVYYSGHSIIVMGPSLSLHQCELYREIAIELSHI 199 +++GK+V YSG S+I++GPSLSLHQC L REIAIEL HI Sbjct: 5 TLLGKRVDYSGRSVIIVGPSLSLHQCGLPREIAIELFHI 43 >ref|YP_002456478.1| RNA polymerase beta [Trifolium subterraneum] gi|193788962|gb|ACF20558.1| RNA polymerase beta [Trifolium subterraneum] Length = 682 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -1 Query: 315 SIIGKQVYYSGHSIIVMGPSLSLHQCELYREIAIELSH 202 +++GK+V YSG S+IV+GPSLSLHQC L REIAIEL H Sbjct: 370 TLLGKRVDYSGRSVIVVGPSLSLHQCGLPREIAIELFH 407 >gb|ADT63246.1| RNA polymerase beta subunit [Juncus dudleyi] Length = 164 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -1 Query: 315 SIIGKQVYYSGHSIIVMGPSLSLHQCELYREIAIELSHIDCVNPMDR 175 +++GK+V YSG S+IV+GPSLSLHQC L REIAIEL I + + R Sbjct: 2 TLLGKRVDYSGRSVIVVGPSLSLHQCGLPREIAIELFQIFLIRTLIR 48 >gb|ADD47681.1| RNA polymerase C [Juncus effusus] gi|290584874|gb|ADD47682.1| RNA polymerase C [Juncus effusus] Length = 164 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -1 Query: 315 SIIGKQVYYSGHSIIVMGPSLSLHQCELYREIAIELSHIDCVNPMDR 175 +++GK+V YSG S+IV+GPSLSLHQC L REIAIEL I + + R Sbjct: 2 TLLGKRVDYSGRSVIVVGPSLSLHQCGLPREIAIELFQIFLIRTLIR 48 >gb|ABU79850.1| RNA polymerase C [Amorphophallus titanum] Length = 172 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -1 Query: 315 SIIGKQVYYSGHSIIVMGPSLSLHQCELYREIAIELSHIDCVNPMDR 175 +++GK+V YSG S+IV+GPSLSLHQC L REIAIEL I + + R Sbjct: 33 TLLGKRVDYSGRSVIVVGPSLSLHQCGLPREIAIELFQIFVIRGLIR 79