BLASTX nr result
ID: Cnidium21_contig00045687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00045687 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275003.1| PREDICTED: RAN GTPase-activating protein 1 i... 57 2e-06 emb|CAN73875.1| hypothetical protein VITISV_039541 [Vitis vinifera] 57 2e-06 emb|CBI26214.3| unnamed protein product [Vitis vinifera] 57 2e-06 emb|CBI20390.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002520743.1| leucine rich repeat-containing protein, puta... 57 2e-06 >ref|XP_002275003.1| PREDICTED: RAN GTPase-activating protein 1 isoform 2 [Vitis vinifera] gi|225436922|ref|XP_002274973.1| PREDICTED: RAN GTPase-activating protein 1 isoform 1 [Vitis vinifera] Length = 541 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/38 (73%), Positives = 34/38 (89%), Gaps = 2/38 (5%) Frame = +1 Query: 166 LTEAAARAVCELIPSTEKLKVLKFHNNR--DEGAISIS 273 ++E AARAVCELIPSTEKL++L+FHNN DEGAI+IS Sbjct: 255 ISEEAARAVCELIPSTEKLRILQFHNNMTGDEGAIAIS 292 >emb|CAN73875.1| hypothetical protein VITISV_039541 [Vitis vinifera] Length = 541 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/38 (73%), Positives = 34/38 (89%), Gaps = 2/38 (5%) Frame = +1 Query: 166 LTEAAARAVCELIPSTEKLKVLKFHNNR--DEGAISIS 273 ++E AARAVCELIPSTEKL++L+FHNN DEGAI+IS Sbjct: 255 ISEEAARAVCELIPSTEKLRILQFHNNMTGDEGAIAIS 292 >emb|CBI26214.3| unnamed protein product [Vitis vinifera] Length = 379 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/38 (73%), Positives = 34/38 (89%), Gaps = 2/38 (5%) Frame = +1 Query: 166 LTEAAARAVCELIPSTEKLKVLKFHNNR--DEGAISIS 273 ++E AARAVCELIPSTEKL+VL+FHNN DEGA++IS Sbjct: 183 ISEEAARAVCELIPSTEKLRVLQFHNNMTGDEGALAIS 220 >emb|CBI20390.3| unnamed protein product [Vitis vinifera] Length = 401 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/38 (73%), Positives = 34/38 (89%), Gaps = 2/38 (5%) Frame = +1 Query: 166 LTEAAARAVCELIPSTEKLKVLKFHNNR--DEGAISIS 273 ++E AARAVCELIPSTEKL+VL+FHNN DEGA++IS Sbjct: 182 ISEEAARAVCELIPSTEKLRVLQFHNNMTGDEGALAIS 219 >ref|XP_002520743.1| leucine rich repeat-containing protein, putative [Ricinus communis] gi|223540128|gb|EEF41705.1| leucine rich repeat-containing protein, putative [Ricinus communis] Length = 546 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/38 (71%), Positives = 34/38 (89%), Gaps = 2/38 (5%) Frame = +1 Query: 166 LTEAAARAVCELIPSTEKLKVLKFHNNR--DEGAISIS 273 ++E AARAVCEL+PSTEKLKVL+FHNN DEGA++I+ Sbjct: 255 ISEEAARAVCELVPSTEKLKVLQFHNNMTGDEGAVAIA 292