BLASTX nr result
ID: Cnidium21_contig00045611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00045611 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulga... 58 7e-07 >emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1357 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/49 (57%), Positives = 32/49 (65%) Frame = +1 Query: 148 LDAILQDVLSFSSTLDFVAWSHVKRGGNCPAHNLVRFVPTGSEQVWVKH 294 LDAIL D+LS + V++SHVKR GN AHNL R VP G EQ W H Sbjct: 1293 LDAILGDILSMCNAFSSVSFSHVKRDGNTVAHNLARVVPFGVEQCWEHH 1341