BLASTX nr result
ID: Cnidium21_contig00045387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00045387 (470 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15364.3| unnamed protein product [Vitis vinifera] 66 3e-09 ref|XP_002273441.1| PREDICTED: uncharacterized protein LOC100268... 66 3e-09 ref|XP_002322048.1| predicted protein [Populus trichocarpa] gi|2... 65 8e-09 ref|XP_002317961.1| predicted protein [Populus trichocarpa] gi|2... 65 8e-09 ref|XP_002514591.1| zinc finger protein, putative [Ricinus commu... 64 1e-08 >emb|CBI15364.3| unnamed protein product [Vitis vinifera] Length = 1427 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 2 LGKQLPCFHRYHGDCIVPWLVTHDTCPVCRYLLP 103 L KQLPC HRYHGDCI+PWL +TCPVCRY LP Sbjct: 1309 LAKQLPCSHRYHGDCIMPWLGIRNTCPVCRYELP 1342 >ref|XP_002273441.1| PREDICTED: uncharacterized protein LOC100268065 [Vitis vinifera] Length = 439 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 2 LGKQLPCFHRYHGDCIVPWLVTHDTCPVCRYLLP 103 L KQLPC HRYHGDCI+PWL +TCPVCRY LP Sbjct: 389 LAKQLPCSHRYHGDCIMPWLGIRNTCPVCRYELP 422 >ref|XP_002322048.1| predicted protein [Populus trichocarpa] gi|222869044|gb|EEF06175.1| predicted protein [Populus trichocarpa] Length = 104 Score = 64.7 bits (156), Expect = 8e-09 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 8 KQLPCFHRYHGDCIVPWLVTHDTCPVCRYLLP 103 KQLPC HRYHG+CIVPWL +TCPVCRY LP Sbjct: 63 KQLPCLHRYHGECIVPWLGIRNTCPVCRYELP 94 >ref|XP_002317961.1| predicted protein [Populus trichocarpa] gi|222858634|gb|EEE96181.1| predicted protein [Populus trichocarpa] Length = 114 Score = 64.7 bits (156), Expect = 8e-09 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 8 KQLPCFHRYHGDCIVPWLVTHDTCPVCRYLLP 103 KQLPC HRYHG+CIVPWL +TCPVCRY LP Sbjct: 73 KQLPCMHRYHGECIVPWLGIRNTCPVCRYELP 104 >ref|XP_002514591.1| zinc finger protein, putative [Ricinus communis] gi|223546195|gb|EEF47697.1| zinc finger protein, putative [Ricinus communis] Length = 479 Score = 64.3 bits (155), Expect = 1e-08 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 8 KQLPCFHRYHGDCIVPWLVTHDTCPVCRYLLP 103 KQLPC HRYHGDCI+PWL +TCPVCRY LP Sbjct: 426 KQLPCTHRYHGDCILPWLGIRNTCPVCRYELP 457