BLASTX nr result
ID: Cnidium21_contig00045323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00045323 (341 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26779.3| unnamed protein product [Vitis vinifera] 62 4e-08 ref|XP_002281669.1| PREDICTED: cyclin-J18-like [Vitis vinifera] 62 4e-08 ref|XP_003544374.1| PREDICTED: cyclin-J18-like [Glycine max] 61 8e-08 >emb|CBI26779.3| unnamed protein product [Vitis vinifera] Length = 118 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -1 Query: 341 PKQRWEFPVIPWVKFVTSCKEADIAENVKDILKHIFETS 225 P+Q+WEFPV+PWVKF TSC E DI E V ILKHIF S Sbjct: 77 PRQKWEFPVLPWVKFATSCNEEDIIEIVGGILKHIFGPS 115 >ref|XP_002281669.1| PREDICTED: cyclin-J18-like [Vitis vinifera] Length = 265 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -1 Query: 341 PKQRWEFPVIPWVKFVTSCKEADIAENVKDILKHIFETS 225 P+Q+WEFPV+PWVKF TSC E DI E V ILKHIF S Sbjct: 224 PRQKWEFPVLPWVKFATSCNEEDIIEIVGGILKHIFGPS 262 >ref|XP_003544374.1| PREDICTED: cyclin-J18-like [Glycine max] Length = 234 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -1 Query: 341 PKQRWEFPVIPWVKFVTSCKEADIAENVKDILKHIFETS 225 PKQ+WEFPV+ WV FVTSCKE DI + V ILKH+ E S Sbjct: 196 PKQKWEFPVLAWVNFVTSCKEQDILKMVTKILKHVLEPS 234