BLASTX nr result
ID: Cnidium21_contig00045143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00045143 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138304.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-09 ref|XP_002318601.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 ref|XP_002514722.1| pentatricopeptide repeat-containing protein,... 62 5e-08 ref|XP_003550790.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-07 emb|CBI28530.3| unnamed protein product [Vitis vinifera] 58 9e-07 >ref|XP_004138304.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Cucumis sativus] gi|449477571|ref|XP_004155060.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Cucumis sativus] Length = 487 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/56 (53%), Positives = 43/56 (76%) Frame = +3 Query: 3 FIKARELWDEAIAMGVDLQVSGDVLDPSVTEVFKPTRKVEDKICLVNHTKPKRNQA 170 F R+LW+EA+AMGV L S ++LDPS+T+VFKPTRK+E+KI ++ K+N+A Sbjct: 419 FEMGRQLWEEAMAMGVSLNCSSEILDPSITKVFKPTRKIENKIVEEFNSAEKQNKA 474 >ref|XP_002318601.1| predicted protein [Populus trichocarpa] gi|222859274|gb|EEE96821.1| predicted protein [Populus trichocarpa] Length = 485 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +3 Query: 3 FIKARELWDEAIAMGVDLQVSGDVLDPSVTEVFKPTRKVEDKICL 137 F + RELW+EA AMGV S DVLDPS+TEVFKP RKVE+ + L Sbjct: 412 FERGRELWEEATAMGVSFSCSSDVLDPSITEVFKPRRKVEEDVKL 456 >ref|XP_002514722.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546326|gb|EEF47828.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 479 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = +3 Query: 3 FIKARELWDEAIAMGVDLQVSGDVLDPSVTEVFKPTRKVEDK 128 F K +ELWDEA+AMGV + S +VLDPS+T+VF+PTRKVE++ Sbjct: 395 FEKGKELWDEAMAMGVTVHCSSEVLDPSITKVFEPTRKVEEE 436 >ref|XP_003550790.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Glycine max] Length = 451 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +3 Query: 3 FIKARELWDEAIAMGVDLQVSGDVLDPSVTEVFKPTR 113 F K RELWDEA MG+ LQ S DVLDPS+TEV+KPTR Sbjct: 376 FEKGRELWDEASGMGITLQCSEDVLDPSITEVYKPTR 412 >emb|CBI28530.3| unnamed protein product [Vitis vinifera] Length = 452 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/49 (55%), Positives = 37/49 (75%) Frame = +3 Query: 3 FIKARELWDEAIAMGVDLQVSGDVLDPSVTEVFKPTRKVEDKICLVNHT 149 F K RELWDEA +GV L S +VLDPS+T+VFKP RK ++++C ++ T Sbjct: 378 FGKGRELWDEATRVGVLLHCSSEVLDPSITKVFKPARK-DEEVCTMSRT 425