BLASTX nr result
ID: Cnidium21_contig00045120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00045120 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314662.1| autoinhibited calcium ATPase [Populus tricho... 75 6e-12 ref|XP_002517056.1| cation-transporting atpase plant, putative [... 74 2e-11 ref|XP_002312557.1| autoinhibited calcium ATPase [Populus tricho... 73 2e-11 ref|XP_002279593.1| PREDICTED: putative calcium-transporting ATP... 68 9e-10 ref|XP_002517055.1| cation-transporting atpase plant, putative [... 68 9e-10 >ref|XP_002314662.1| autoinhibited calcium ATPase [Populus trichocarpa] gi|222863702|gb|EEF00833.1| autoinhibited calcium ATPase [Populus trichocarpa] Length = 998 Score = 75.1 bits (183), Expect = 6e-12 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 3 LNWGQWGTCIGIAVLSWPIAFLVKYIPVPEKPLFSFLKW 119 LNWGQWG CIGIA LSWPI ++VK IPVPEKP+FS+L W Sbjct: 958 LNWGQWGACIGIAALSWPIGWVVKCIPVPEKPIFSYLTW 996 >ref|XP_002517056.1| cation-transporting atpase plant, putative [Ricinus communis] gi|223543691|gb|EEF45219.1| cation-transporting atpase plant, putative [Ricinus communis] Length = 1013 Score = 73.6 bits (179), Expect = 2e-11 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +3 Query: 3 LNWGQWGTCIGIAVLSWPIAFLVKYIPVPEKPLFSFLKW 119 LNWGQWG CIG+A L+WPI +LVK+IPVPEKP+ S+L W Sbjct: 973 LNWGQWGACIGMATLTWPIGWLVKFIPVPEKPILSYLTW 1011 >ref|XP_002312557.1| autoinhibited calcium ATPase [Populus trichocarpa] gi|222852377|gb|EEE89924.1| autoinhibited calcium ATPase [Populus trichocarpa] Length = 984 Score = 73.2 bits (178), Expect = 2e-11 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 3 LNWGQWGTCIGIAVLSWPIAFLVKYIPVPEKPLFSFLKW 119 LNWGQWG CIG A LSWPI ++VK IPVPEKP+FS+L W Sbjct: 944 LNWGQWGACIGTAALSWPICWVVKCIPVPEKPIFSYLTW 982 >ref|XP_002279593.1| PREDICTED: putative calcium-transporting ATPase 13, plasma membrane-type-like [Vitis vinifera] Length = 1011 Score = 67.8 bits (164), Expect = 9e-10 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 3 LNWGQWGTCIGIAVLSWPIAFLVKYIPVPEKPLFSFLKW 119 LNWGQWG CIGIA SWPI ++VK IPV +KP S+LKW Sbjct: 973 LNWGQWGACIGIAAASWPIGWVVKGIPVSDKPFLSYLKW 1011 >ref|XP_002517055.1| cation-transporting atpase plant, putative [Ricinus communis] gi|223543690|gb|EEF45218.1| cation-transporting atpase plant, putative [Ricinus communis] Length = 1018 Score = 67.8 bits (164), Expect = 9e-10 Identities = 24/39 (61%), Positives = 33/39 (84%) Frame = +3 Query: 3 LNWGQWGTCIGIAVLSWPIAFLVKYIPVPEKPLFSFLKW 119 LNW QWG CIG+A +SWPI + +K +PVP+KP+FS++KW Sbjct: 978 LNWVQWGACIGMAAISWPIGWSIKSLPVPDKPIFSYIKW 1016