BLASTX nr result
ID: Cnidium21_contig00045102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00045102 (501 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520709.1| conserved hypothetical protein [Ricinus comm... 71 1e-10 ref|XP_004135609.1| PREDICTED: SOSS complex subunit B homolog [C... 65 4e-09 ref|NP_001237260.1| uncharacterized protein LOC100500643 [Glycin... 65 4e-09 ref|XP_003598314.1| SOSS complex subunit B1 [Medicago truncatula... 63 2e-08 ref|XP_003598313.1| SOSS complex subunit B1 [Medicago truncatula... 63 2e-08 >ref|XP_002520709.1| conserved hypothetical protein [Ricinus communis] gi|223540094|gb|EEF41671.1| conserved hypothetical protein [Ricinus communis] Length = 145 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = -2 Query: 263 EKVGEFTMVFVETPNMSEIHWVPDPNNSKIYVKKDALSNNFERFPQ 126 EKVGEFTM FVETPNMSEI WVPDPNNSK YV++ +S + FP+ Sbjct: 98 EKVGEFTMAFVETPNMSEIRWVPDPNNSKKYVQEAVISTHSRIFPR 143 >ref|XP_004135609.1| PREDICTED: SOSS complex subunit B homolog [Cucumis sativus] gi|449485696|ref|XP_004157248.1| PREDICTED: SOSS complex subunit B homolog [Cucumis sativus] Length = 139 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/45 (71%), Positives = 33/45 (73%) Frame = -2 Query: 263 EKVGEFTMVFVETPNMSEIHWVPDPNNSKIYVKKDALSNNFERFP 129 EKVGEF MVFVETPNMSEIHWVPD NS YVK+ LS FP Sbjct: 92 EKVGEFKMVFVETPNMSEIHWVPDTINSNKYVKESVLSPYSRIFP 136 >ref|NP_001237260.1| uncharacterized protein LOC100500643 [Glycine max] gi|255630841|gb|ACU15783.1| unknown [Glycine max] Length = 139 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -2 Query: 260 KVGEFTMVFVETPNMSEIHWVPDPNNSKIYVKKDALSNNFERFP 129 KVG FTM FVETPNMSEIHW+PDPNNSK Y+++ +S FP Sbjct: 91 KVGGFTMAFVETPNMSEIHWIPDPNNSKNYIQQYVISPVSRIFP 134 >ref|XP_003598314.1| SOSS complex subunit B1 [Medicago truncatula] gi|355487362|gb|AES68565.1| SOSS complex subunit B1 [Medicago truncatula] Length = 147 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -2 Query: 263 EKVGEFTMVFVETPNMSEIHWVPDPNNSKIYVKKDALSNNFERF 132 EK+GEFTM +VETPNMSEIHW+PDP N K Y+++ +S + F Sbjct: 100 EKIGEFTMSYVETPNMSEIHWIPDPTNPKKYIQEYVISPHSRAF 143 >ref|XP_003598313.1| SOSS complex subunit B1 [Medicago truncatula] gi|355487361|gb|AES68564.1| SOSS complex subunit B1 [Medicago truncatula] Length = 196 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -2 Query: 263 EKVGEFTMVFVETPNMSEIHWVPDPNNSKIYVKKDALSNNFERF 132 EK+GEFTM +VETPNMSEIHW+PDP N K Y+++ +S + F Sbjct: 149 EKIGEFTMSYVETPNMSEIHWIPDPTNPKKYIQEYVISPHSRAF 192