BLASTX nr result
ID: Cnidium21_contig00045066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00045066 (397 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003613548.1| Thioredoxin [Medicago truncatula] gi|2693158... 67 1e-09 ref|XP_003519131.1| PREDICTED: thioredoxin H2-like [Glycine max] 65 4e-09 ref|XP_003613544.1| Thioredoxin-2 [Medicago truncatula] gi|26931... 65 7e-09 ref|XP_003517914.1| PREDICTED: thioredoxin H7-like [Glycine max] 64 1e-08 gb|AFK34683.1| unknown [Lotus japonicus] 64 1e-08 >ref|XP_003613548.1| Thioredoxin [Medicago truncatula] gi|269315888|gb|ACZ37070.1| thioredoxin h6 [Medicago truncatula] gi|355514883|gb|AES96506.1| Thioredoxin [Medicago truncatula] gi|388507752|gb|AFK41942.1| unknown [Medicago truncatula] Length = 128 Score = 67.0 bits (162), Expect = 1e-09 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -3 Query: 341 MVIHFTAAWCGPCRTMEPVIHDFAAKYVGLEFIQIDVD 228 MVI FTAAWCGPC+ M+P+I DFAAKY+ ++FI+IDVD Sbjct: 45 MVIEFTAAWCGPCKYMDPIIQDFAAKYIKVDFIKIDVD 82 >ref|XP_003519131.1| PREDICTED: thioredoxin H2-like [Glycine max] Length = 128 Score = 65.5 bits (158), Expect = 4e-09 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = -3 Query: 341 MVIHFTAAWCGPCRTMEPVIHDFAAKYVGLEFIQIDVDR*TGSMHE 204 MVI FTA WCGPC++M+P+I ++AAKY +EFI+IDVD G E Sbjct: 45 MVIDFTATWCGPCKSMDPIIQEYAAKYTNVEFIKIDVDELMGVSQE 90 >ref|XP_003613544.1| Thioredoxin-2 [Medicago truncatula] gi|269315886|gb|ACZ37069.1| thioredoxin h5 [Medicago truncatula] gi|355514879|gb|AES96502.1| Thioredoxin-2 [Medicago truncatula] Length = 126 Score = 64.7 bits (156), Expect = 7e-09 Identities = 30/54 (55%), Positives = 37/54 (68%), Gaps = 5/54 (9%) Frame = -3 Query: 341 MVIHFTAAWCGPCRTMEPVIHDFAAKYVGLEFIQIDVDR*TG-----SMHELST 195 MVI FTA WCGPC+ M+PV+ DFAAKY +EFI++DVD G +H L T Sbjct: 43 MVIDFTAKWCGPCKVMDPVMKDFAAKYTDVEFIKLDVDELMGVSQTFQVHSLPT 96 >ref|XP_003517914.1| PREDICTED: thioredoxin H7-like [Glycine max] Length = 124 Score = 64.3 bits (155), Expect = 1e-08 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -3 Query: 341 MVIHFTAAWCGPCRTMEPVIHDFAAKYVGLEFIQIDVD 228 MVI FTA WCGPC++M+P+I ++AAKY +EFI+IDVD Sbjct: 41 MVIDFTATWCGPCKSMDPIIQEYAAKYTNVEFIKIDVD 78 >gb|AFK34683.1| unknown [Lotus japonicus] Length = 115 Score = 63.9 bits (154), Expect = 1e-08 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 341 MVIHFTAAWCGPCRTMEPVIHDFAAKYVGLEFIQIDVD 228 MVI FTA WCGPC++MEP+I +F AKY +EFI+IDVD Sbjct: 43 MVIDFTAKWCGPCKSMEPIIQEFVAKYTKVEFIKIDVD 80