BLASTX nr result
ID: Cnidium21_contig00045049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00045049 (335 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526119.1| ubiquitin-protein ligase, putative [Ricinus ... 65 4e-09 ref|XP_002308787.1| f-box family protein [Populus trichocarpa] g... 62 6e-08 ref|XP_002532719.1| ubiquitin-protein ligase, putative [Ricinus ... 57 1e-06 ref|XP_002520466.1| ubiquitin-protein ligase, putative [Ricinus ... 55 5e-06 >ref|XP_002526119.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223534616|gb|EEF36313.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 414 Score = 65.5 bits (158), Expect = 4e-09 Identities = 41/111 (36%), Positives = 61/111 (54%), Gaps = 6/111 (5%) Frame = -1 Query: 335 VSKEWCSIIDSPAFVKKHLKNSIKCNPNGDGVFITGAQYCLTHLDSLYDAN-DA--TVIS 165 +SK WC+ ID P F+K HLK S + N N +F +H D Y+ N D+ ++I Sbjct: 28 ISKSWCAKIDDPNFIKTHLKKSRETNSNLTLIFAG------SHPDYFYNVNLDSLNSIIK 81 Query: 164 LDDTLKDVLSGAH---FVGAANCLVCFCKNKMNEFLLLNPSTRKYRKIPRL 21 L++ +K +H VG+ N L+CF N L+NPSTRK++ +P L Sbjct: 82 LENPIKGPTDASHNIKIVGSCNGLLCF-GNASGRITLMNPSTRKHKVLPFL 131 >ref|XP_002308787.1| f-box family protein [Populus trichocarpa] gi|222854763|gb|EEE92310.1| f-box family protein [Populus trichocarpa] Length = 396 Score = 61.6 bits (148), Expect = 6e-08 Identities = 38/107 (35%), Positives = 57/107 (53%), Gaps = 1/107 (0%) Frame = -1 Query: 335 VSKEWCSIIDSPAFVKKHLKNSIKCNPNGDGVFITGAQYCLTHLDSLYDAND-ATVISLD 159 VSK WC++ID P FVK HLK+S+ + N + T + + ND T+ L+ Sbjct: 27 VSKPWCALIDGPNFVKLHLKHSMDTSSNLYIILRTTSHVHYMDFEQNLVLNDCVTLKELN 86 Query: 158 DTLKDVLSGAHFVGAANCLVCFCKNKMNEFLLLNPSTRKYRKIPRLP 18 L G +G+ N L+C N +++ + NPSTRK+R +P LP Sbjct: 87 HPLMCYNHGIKVLGSVNGLLCI-SNVVDDIAVWNPSTRKHRVVPFLP 132 >ref|XP_002532719.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223527546|gb|EEF29668.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 389 Score = 57.4 bits (137), Expect = 1e-06 Identities = 37/106 (34%), Positives = 55/106 (51%) Frame = -1 Query: 335 VSKEWCSIIDSPAFVKKHLKNSIKCNPNGDGVFITGAQYCLTHLDSLYDANDATVISLDD 156 VSK W ++IDSP F+ HL +SI+ N + + Y L+ +D D + LD Sbjct: 27 VSKRWRTLIDSPTFIYLHLNHSIESPCNLSIILKSSELYSLS-----FDLLD-NIQPLDH 80 Query: 155 TLKDVLSGAHFVGAANCLVCFCKNKMNEFLLLNPSTRKYRKIPRLP 18 L G +G+ N L+C C N +++ L NPS R +R +P LP Sbjct: 81 PLMCYNHGVKILGSCNGLLCIC-NIVDDIALWNPSIRAHRVVPYLP 125 >ref|XP_002520466.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223540308|gb|EEF41879.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 358 Score = 55.5 bits (132), Expect = 5e-06 Identities = 35/114 (30%), Positives = 54/114 (47%), Gaps = 6/114 (5%) Frame = -1 Query: 335 VSKEWCSIIDSPAFVKKHLKNSIKCNPNGDGVFI------TGAQYCLTHLDSLYDANDAT 174 +SK +C++ID+P F+K HL SI+ P + + Y H L D Sbjct: 27 ISKSYCTLIDNPDFIKAHLDTSIQTKPRKKLILLRHQSNGVAEFYAADHNGGLIDP---- 82 Query: 173 VISLDDTLKDVLSGAHFVGAANCLVCFCKNKMNEFLLLNPSTRKYRKIPRLPRK 12 I L +K +G VG+ N LV +N ++ LL NP T +Y+ +P R+ Sbjct: 83 -IKLKSPIKSKSNGTRIVGSCNSLVLLMQN-TDKLLLWNPFTTQYKILPEPQRE 134