BLASTX nr result
ID: Cnidium21_contig00044980
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00044980 (380 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN76336.1| hypothetical protein VITISV_015724 [Vitis vinifera] 47 7e-09 ref|XP_002444255.1| hypothetical protein SORBIDRAFT_07g019075 [S... 44 3e-08 ref|XP_002437135.1| hypothetical protein SORBIDRAFT_10g021820 [S... 44 4e-08 ref|XP_002440813.1| hypothetical protein SORBIDRAFT_09g007280 [S... 44 4e-08 ref|XP_002453791.1| hypothetical protein SORBIDRAFT_04g017480 [S... 44 5e-08 >emb|CAN76336.1| hypothetical protein VITISV_015724 [Vitis vinifera] Length = 672 Score = 46.6 bits (109), Expect(2) = 7e-09 Identities = 26/55 (47%), Positives = 32/55 (58%) Frame = -2 Query: 292 MDRQAWMYNISRVEDDYIMGVNDFLLCALEHQKKKEEENGYKDSISCPCLLCGNL 128 MDR +WM R DY+ GV FL AL+H + YK+SI CPCL CGN+ Sbjct: 1 MDR-SWMTK-DRRSKDYVDGVESFLAFALKH-------SAYKNSIKCPCLQCGNM 46 Score = 38.1 bits (87), Expect(2) = 7e-09 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 120 FSDIEIVRDHLFRHGFKRNYTNWIWHGEVIDSGGTSRR 7 F + +R+HLF +G ++Y W WHG+ SG + R Sbjct: 48 FHTSQKIREHLFFYGIDQSYHTWYWHGDAAPSGPPTSR 85 >ref|XP_002444255.1| hypothetical protein SORBIDRAFT_07g019075 [Sorghum bicolor] gi|241940605|gb|EES13750.1| hypothetical protein SORBIDRAFT_07g019075 [Sorghum bicolor] Length = 421 Score = 43.5 bits (101), Expect(2) = 3e-08 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -3 Query: 114 DIEIVRDHLFRHGFKRNYTNWIWHGEVI 31 D+EI+R HL R GF NYT W+ HGEV+ Sbjct: 59 DVEIIRSHLIRQGFVPNYTIWLHHGEVM 86 Score = 39.3 bits (90), Expect(2) = 3e-08 Identities = 19/53 (35%), Positives = 25/53 (47%) Frame = -2 Query: 289 DRQAWMYNISRVEDDYIMGVNDFLLCALEHQKKKEEENGYKDSISCPCLLCGN 131 +R WMY + R Y V+ F+ A+ H K N Y S+ CPC C N Sbjct: 3 NRATWMYGLPRYSQAYADEVDKFITIAVNHAKTLSAGNNY--SVICPCKDCKN 53 >ref|XP_002437135.1| hypothetical protein SORBIDRAFT_10g021820 [Sorghum bicolor] gi|241915358|gb|EER88502.1| hypothetical protein SORBIDRAFT_10g021820 [Sorghum bicolor] Length = 221 Score = 43.5 bits (101), Expect(2) = 4e-08 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -3 Query: 114 DIEIVRDHLFRHGFKRNYTNWIWHGEVI 31 D+EI+R HL R GF NYT W+ HGEV+ Sbjct: 59 DVEIIRSHLIRRGFVPNYTVWLHHGEVM 86 Score = 38.9 bits (89), Expect(2) = 4e-08 Identities = 19/53 (35%), Positives = 26/53 (49%) Frame = -2 Query: 289 DRQAWMYNISRVEDDYIMGVNDFLLCALEHQKKKEEENGYKDSISCPCLLCGN 131 +R WMY ++R Y V+ F+ A+ H K E N S+ CPC C N Sbjct: 3 NRATWMYGLTRYSQAYADEVDKFITIAVNHAKTLSEGNNC--SVICPCKDCKN 53 >ref|XP_002440813.1| hypothetical protein SORBIDRAFT_09g007280 [Sorghum bicolor] gi|241946098|gb|EES19243.1| hypothetical protein SORBIDRAFT_09g007280 [Sorghum bicolor] Length = 467 Score = 43.5 bits (101), Expect(2) = 4e-08 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -3 Query: 114 DIEIVRDHLFRHGFKRNYTNWIWHGEVI 31 D+EI+R HL R GF NYT W+ HGEV+ Sbjct: 59 DVEIIRSHLIRRGFVPNYTVWLHHGEVM 86 Score = 38.5 bits (88), Expect(2) = 4e-08 Identities = 19/53 (35%), Positives = 25/53 (47%) Frame = -2 Query: 289 DRQAWMYNISRVEDDYIMGVNDFLLCALEHQKKKEEENGYKDSISCPCLLCGN 131 +R WMY + R Y V+ F+ A+ H K EN S+ CPC C N Sbjct: 3 NRATWMYGLPRYSQAYADEVDKFITVAVNHAKTLSAENNC--SVICPCKDCKN 53 >ref|XP_002453791.1| hypothetical protein SORBIDRAFT_04g017480 [Sorghum bicolor] gi|241933622|gb|EES06767.1| hypothetical protein SORBIDRAFT_04g017480 [Sorghum bicolor] Length = 290 Score = 43.5 bits (101), Expect(2) = 5e-08 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -3 Query: 114 DIEIVRDHLFRHGFKRNYTNWIWHGEVI 31 D+EI+R HL R GF NYT W+ HGEV+ Sbjct: 59 DVEIIRSHLIRRGFVPNYTVWLHHGEVM 86 Score = 38.5 bits (88), Expect(2) = 5e-08 Identities = 19/53 (35%), Positives = 25/53 (47%) Frame = -2 Query: 289 DRQAWMYNISRVEDDYIMGVNDFLLCALEHQKKKEEENGYKDSISCPCLLCGN 131 +R WMY + R Y V+ F+ A+ H K EN S+ CPC C N Sbjct: 3 NRATWMYGLPRYSQAYADEVDKFITIAVNHAKTLSAENNC--SVICPCKDCKN 53