BLASTX nr result
ID: Cnidium21_contig00044876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00044876 (405 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65182.1| hypothetical protein VITISV_029570 [Vitis vinifera] 55 6e-06 >emb|CAN65182.1| hypothetical protein VITISV_029570 [Vitis vinifera] Length = 1002 Score = 55.1 bits (131), Expect = 6e-06 Identities = 20/43 (46%), Positives = 29/43 (67%) Frame = +2 Query: 203 CTHCQVPGHSLDRCFKIHGYPINFKGKDTRMAGFVQNSQEGQM 331 CTHC + GH++DRC+K+HGYP+ +K K G VQ +Q + Sbjct: 182 CTHCGLQGHAMDRCYKLHGYPLGYKPKSKSQLGQVQANQTSSL 224