BLASTX nr result
ID: Cnidium21_contig00044824
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00044824 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK46055.1| unknown [Lotus japonicus] 56 3e-06 gb|EEH47596.1| proteasome component PRE2 [Paracoccidioides brasi... 55 8e-06 ref|XP_002797291.1| proteasome component PRE2 [Paracoccidioides ... 55 8e-06 gb|EEH19404.1| proteasome subunit beta type-5 [Paracoccidioides ... 55 8e-06 ref|XP_750720.1| proteasome component Pre2 [Aspergillus fumigatu... 55 8e-06 >gb|AFK46055.1| unknown [Lotus japonicus] Length = 270 Score = 55.8 bits (133), Expect = 3e-06 Identities = 31/60 (51%), Positives = 38/60 (63%) Frame = +3 Query: 3 LHGTLFCQGSGSQYAYHVLDARYCYDMTKLEDAHLAVLSIKYASDHDICTGGFAIVCHIG 182 L GT F GSGS YAY VLD+ Y YDM+ E A LA +I +A+ D +GG A V H+G Sbjct: 176 LKGTRFSVGSGSPYAYGVLDSGYKYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVG 235 >gb|EEH47596.1| proteasome component PRE2 [Paracoccidioides brasiliensis Pb18] Length = 283 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/59 (49%), Positives = 35/59 (59%) Frame = +3 Query: 3 LHGTLFCQGSGSQYAYHVLDARYCYDMTKLEDAHLAVLSIKYASDHDICTGGFAIVCHI 179 L G LFC GSG +AY VLDA Y YD+T+ E L SI A+ D +GGF + HI Sbjct: 190 LAGNLFCVGSGQTFAYGVLDAEYRYDLTEEEALELGRRSILAATHRDAYSGGFINLYHI 248 >ref|XP_002797291.1| proteasome component PRE2 [Paracoccidioides sp. 'lutzii' Pb01] gi|226282663|gb|EEH38229.1| proteasome component PRE2 [Paracoccidioides sp. 'lutzii' Pb01] Length = 283 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/59 (49%), Positives = 35/59 (59%) Frame = +3 Query: 3 LHGTLFCQGSGSQYAYHVLDARYCYDMTKLEDAHLAVLSIKYASDHDICTGGFAIVCHI 179 L G LFC GSG +AY VLDA Y YD+T+ E L SI A+ D +GGF + HI Sbjct: 190 LAGNLFCVGSGQTFAYGVLDAEYRYDLTEEEALELGRRSILAATHRDAYSGGFINLYHI 248 >gb|EEH19404.1| proteasome subunit beta type-5 [Paracoccidioides brasiliensis Pb03] Length = 283 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/59 (49%), Positives = 35/59 (59%) Frame = +3 Query: 3 LHGTLFCQGSGSQYAYHVLDARYCYDMTKLEDAHLAVLSIKYASDHDICTGGFAIVCHI 179 L G LFC GSG +AY VLDA Y YD+T+ E L SI A+ D +GGF + HI Sbjct: 190 LAGNLFCVGSGQTFAYGVLDAEYRYDLTEEEALELGRRSILAATHRDAYSGGFINLYHI 248 >ref|XP_750720.1| proteasome component Pre2 [Aspergillus fumigatus Af293] gi|66848353|gb|EAL88682.1| proteasome component Pre2, putative [Aspergillus fumigatus Af293] Length = 296 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/59 (47%), Positives = 34/59 (57%) Frame = +3 Query: 3 LHGTLFCQGSGSQYAYHVLDARYCYDMTKLEDAHLAVLSIKYASDHDICTGGFAIVCHI 179 L G LFC GSG +AY VLDA Y YD+T+ E L SI A D +GGF + H+ Sbjct: 204 LSGNLFCVGSGQTFAYGVLDAEYRYDLTEEEALELGCRSILAAMHRDAYSGGFINLYHV 262