BLASTX nr result
ID: Cnidium21_contig00044641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00044641 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004169575.1| PREDICTED: protein ECERIFERUM 3-like, partia... 60 1e-07 ref|XP_004149879.1| PREDICTED: protein ECERIFERUM 3-like [Cucumi... 60 1e-07 ref|XP_002325096.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-07 gb|AEW67744.1| WAX2 protein [Eutrema halophilum] 59 5e-07 dbj|BAJ33654.1| unnamed protein product [Thellungiella halophila] 59 5e-07 >ref|XP_004169575.1| PREDICTED: protein ECERIFERUM 3-like, partial [Cucumis sativus] Length = 218 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 HHEVGALDVDRIDIVWEAALKHGFRPVSNK 90 HHEVGALDVDRID+VWEAALKHG +PVS K Sbjct: 189 HHEVGALDVDRIDLVWEAALKHGLKPVSTK 218 >ref|XP_004149879.1| PREDICTED: protein ECERIFERUM 3-like [Cucumis sativus] Length = 625 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 HHEVGALDVDRIDIVWEAALKHGFRPVSNK 90 HHEVGALDVDRID+VWEAALKHG +PVS K Sbjct: 596 HHEVGALDVDRIDLVWEAALKHGLKPVSTK 625 >ref|XP_002325096.1| predicted protein [Populus trichocarpa] gi|222866530|gb|EEF03661.1| predicted protein [Populus trichocarpa] Length = 652 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 HHEVGALDVDRIDIVWEAALKHGFRPVSN 87 HHEVGALDVDRID+VW AALKHG +PVSN Sbjct: 617 HHEVGALDVDRIDVVWNAALKHGLKPVSN 645 >gb|AEW67744.1| WAX2 protein [Eutrema halophilum] Length = 157 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 1 HHEVGALDVDRIDIVWEAALKHGFRPVSNKNN 96 HHEVGA+DVDRID+VWEAA+K+G RPVS+ N Sbjct: 126 HHEVGAIDVDRIDLVWEAAMKYGLRPVSSSQN 157 >dbj|BAJ33654.1| unnamed protein product [Thellungiella halophila] Length = 631 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 1 HHEVGALDVDRIDIVWEAALKHGFRPVSNKNN 96 HHEVGA+DVDRID+VWEAA+K+G RPVS+ N Sbjct: 600 HHEVGAIDVDRIDLVWEAAMKYGLRPVSSSQN 631