BLASTX nr result
ID: Cnidium21_contig00044628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00044628 (411 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533783.1| pentatricopeptide repeat-containing protein,... 65 7e-09 ref|XP_003547574.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-08 emb|CBI31086.3| unnamed protein product [Vitis vinifera] 63 3e-08 ref|NP_193861.1| pentatricopeptide repeat-containing protein [Ar... 62 5e-08 ref|XP_003535029.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 >ref|XP_002533783.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526284|gb|EEF28596.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 672 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = -2 Query: 407 HMFVAAHTSHSYVAEIYFILNHLLLELRKEGYVPQPYLPLHMES 276 HMFVAA SH A+IY +LN+LLLELRKEGY P+PYLP+H ++ Sbjct: 626 HMFVAADGSHPESAQIYSVLNNLLLELRKEGYCPKPYLPMHPQT 669 >ref|XP_003547574.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] Length = 846 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = -2 Query: 407 HMFVAAHTSHSYVAEIYFILNHLLLELRKEGYVPQPYLPLH 285 HMF AA +H EIY ILN LLLELRK+GYVPQPYLPLH Sbjct: 799 HMFSAAEGNHPESVEIYLILNSLLLELRKQGYVPQPYLPLH 839 >emb|CBI31086.3| unnamed protein product [Vitis vinifera] Length = 766 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/57 (50%), Positives = 40/57 (70%), Gaps = 5/57 (8%) Frame = -2 Query: 407 HMFVAAHTSHSYVAEIYFILNHLLLELRKEGYVPQPYLPLH-----MESSKLTYLHN 252 HMFVAA SH ++IY +L +L LELRKEGYVPQ YLP+H + + +++Y H+ Sbjct: 702 HMFVAADRSHPQSSQIYLLLKNLFLELRKEGYVPQLYLPMHPQTMGLHNGRISYYHS 758 >ref|NP_193861.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75207660|sp|Q9STE1.1|PP333_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g21300 gi|3402749|emb|CAA20195.1| putative protein [Arabidopsis thaliana] gi|7268926|emb|CAB79129.1| putative protein [Arabidopsis thaliana] gi|332659037|gb|AEE84437.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 857 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = -2 Query: 407 HMFVAAHTSHSYVAEIYFILNHLLLELRKEGYVPQPYLPLHMESSKLTY 261 H+FV+ +H + IY +LN LL ELR EGY+PQPYLPLH ESS+ Y Sbjct: 793 HLFVSGDVNHPESSHIYSLLNSLLGELRLEGYIPQPYLPLHPESSRKVY 841 >ref|XP_003535029.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] Length = 813 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = -2 Query: 407 HMFVAAHTSHSYVAEIYFILNHLLLELRKEGYVPQPYLPLH 285 HMF AA +H EIY IL LLLELRK+GYVPQPYLPLH Sbjct: 766 HMFSAADGNHPESVEIYLILKSLLLELRKQGYVPQPYLPLH 806