BLASTX nr result
ID: Cnidium21_contig00044581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00044581 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516008.1| nitrate transporter, putative [Ricinus commu... 67 2e-09 ref|NP_188239.1| major facilitator protein [Arabidopsis thaliana... 66 3e-09 dbj|BAB02684.1| peptide/amino acid transporter-like protein [Ara... 66 3e-09 ref|XP_004170441.1| PREDICTED: probable peptide transporter At1g... 65 4e-09 ref|XP_004141840.1| PREDICTED: probable peptide transporter At1g... 65 4e-09 >ref|XP_002516008.1| nitrate transporter, putative [Ricinus communis] gi|223544913|gb|EEF46428.1| nitrate transporter, putative [Ricinus communis] Length = 612 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 2/73 (2%) Frame = +3 Query: 3 YESYYWLLAVMSFINILYFMVCSWAYGPCVEQKNGVRRENVDGFATSGQELLKPKPAQIT 182 Y++YYWLLA+MS +N+LYF++CSW YGPC EQ + + + +G +E + I Sbjct: 542 YDNYYWLLAIMSAVNLLYFLICSWGYGPCKEQ---ITKVSDEGNGFKHEEEPCNLGSMIK 598 Query: 183 DDGKNI--EELRR 215 D+GK I EEL R Sbjct: 599 DEGKGIDGEELSR 611 >ref|NP_188239.1| major facilitator protein [Arabidopsis thaliana] gi|310947330|sp|Q8LPL2.2|PTR32_ARATH RecName: Full=Probable peptide/nitrate transporter At3g16180 gi|332642260|gb|AEE75781.1| major facilitator protein [Arabidopsis thaliana] Length = 591 Score = 65.9 bits (159), Expect = 3e-09 Identities = 25/53 (47%), Positives = 41/53 (77%) Frame = +3 Query: 3 YESYYWLLAVMSFINILYFMVCSWAYGPCVEQKNGVRRENVDGFATSGQELLK 161 Y+ YYW+LA++SF+N++Y++VCSW+YGP V+Q VR + V+G +E++K Sbjct: 540 YDYYYWVLAILSFVNVIYYVVCSWSYGPTVDQ---VRNDKVNGMRKEEEEVIK 589 >dbj|BAB02684.1| peptide/amino acid transporter-like protein [Arabidopsis thaliana] Length = 541 Score = 65.9 bits (159), Expect = 3e-09 Identities = 25/53 (47%), Positives = 41/53 (77%) Frame = +3 Query: 3 YESYYWLLAVMSFINILYFMVCSWAYGPCVEQKNGVRRENVDGFATSGQELLK 161 Y+ YYW+LA++SF+N++Y++VCSW+YGP V+Q VR + V+G +E++K Sbjct: 490 YDYYYWVLAILSFVNVIYYVVCSWSYGPTVDQ---VRNDKVNGMRKEEEEVIK 539 >ref|XP_004170441.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis sativus] Length = 500 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/74 (39%), Positives = 49/74 (66%) Frame = +3 Query: 3 YESYYWLLAVMSFINILYFMVCSWAYGPCVEQKNGVRRENVDGFATSGQELLKPKPAQIT 182 +E YYWLLA++S IN+LY++VCSWAYGP V+Q+ R DG +S ++ L A++ Sbjct: 430 FEKYYWLLAILSVINVLYYVVCSWAYGPSVDQR---RTAMDDGKISSNEDELSMLDARVK 486 Query: 183 DDGKNIEELRRSKA 224 ++ + +++ +A Sbjct: 487 EEEGELHKVKELEA 500 >ref|XP_004141840.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis sativus] Length = 608 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/74 (39%), Positives = 49/74 (66%) Frame = +3 Query: 3 YESYYWLLAVMSFINILYFMVCSWAYGPCVEQKNGVRRENVDGFATSGQELLKPKPAQIT 182 +E YYWLLA++S IN+LY++VCSWAYGP V+Q+ R DG +S ++ L A++ Sbjct: 538 FEKYYWLLAILSVINVLYYVVCSWAYGPSVDQR---RTAMDDGKISSNEDELSMLDARVK 594 Query: 183 DDGKNIEELRRSKA 224 ++ + +++ +A Sbjct: 595 EEEGELHKVKELEA 608