BLASTX nr result
ID: Cnidium21_contig00044503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00044503 (356 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF62469.1| hypothetical protein [Nicotiana tabacum] 62 1e-10 ref|XP_003532848.1| PREDICTED: BTB/POZ domain-containing protein... 65 5e-10 ref|XP_003631414.1| PREDICTED: BTB/POZ domain-containing protein... 59 2e-09 ref|XP_003525389.1| PREDICTED: BTB/POZ domain-containing protein... 63 1e-08 ref|XP_002509821.1| potassium channel tetramerization domain-con... 57 2e-08 >dbj|BAF62469.1| hypothetical protein [Nicotiana tabacum] Length = 463 Score = 61.6 bits (148), Expect(2) = 1e-10 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = -2 Query: 118 ALILFYLRTGNLPSKAKAFDLQDLVFEAKFYGIEELLVN 2 +++L LRTGNLPSKAK FD+QDL+FE++FYG+E LL+N Sbjct: 73 SILLSLLRTGNLPSKAKTFDIQDLIFESQFYGVEHLLLN 111 Score = 28.9 bits (63), Expect(2) = 1e-10 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -1 Query: 212 SKQPDSSSSNIFTIDVGGXXXXXXXXXXXQSGPDSILSK 96 S+ S+SNI TIDVGG QSG S+LS+ Sbjct: 15 SRNSIDSASNIITIDVGGQLFQTTKQTLKQSGSKSLLSE 53 >ref|XP_003532848.1| PREDICTED: BTB/POZ domain-containing protein At5g41330-like [Glycine max] Length = 461 Score = 65.5 bits (158), Expect(2) = 5e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -2 Query: 118 ALILFYLRTGNLPSKAKAFDLQDLVFEAKFYGIEELLVN 2 +L+L LRTGNLPSKAKAFDLQDL+ E+KFYGIE LLVN Sbjct: 68 SLLLSLLRTGNLPSKAKAFDLQDLIIESKFYGIESLLVN 106 Score = 23.1 bits (48), Expect(2) = 5e-10 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -1 Query: 188 SNIFTIDVGGXXXXXXXXXXXQSGPDSILSK 96 SNI +IDVGG +GP + S+ Sbjct: 17 SNIVSIDVGGQLFQTTKQTLTSAGPKTFFSR 47 >ref|XP_003631414.1| PREDICTED: BTB/POZ domain-containing protein At5g41330-like [Vitis vinifera] Length = 464 Score = 58.9 bits (141), Expect(2) = 2e-09 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 118 ALILFYLRTGNLPSKAKAFDLQDLVFEAKFYGIEELLVN 2 +++L LRTGNLPSKAKA DLQDL EAKFYGIE LLV+ Sbjct: 69 SILLSLLRTGNLPSKAKAVDLQDLFSEAKFYGIESLLVS 107 Score = 27.7 bits (60), Expect(2) = 2e-09 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 Query: 188 SNIFTIDVGGXXXXXXXXXXXQSGPDSILSK 96 SNI TIDVGG +GP S+ SK Sbjct: 16 SNIVTIDVGGQIFQTTKQTLTLAGPKSLFSK 46 >ref|XP_003525389.1| PREDICTED: BTB/POZ domain-containing protein At5g41330-like [Glycine max] Length = 458 Score = 62.8 bits (151), Expect(2) = 1e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -2 Query: 118 ALILFYLRTGNLPSKAKAFDLQDLVFEAKFYGIEELLVN 2 +L+L LRTGNLPSKAK FDLQDL E+KFYGIE LLVN Sbjct: 68 SLLLSLLRTGNLPSKAKTFDLQDLTIESKFYGIESLLVN 106 Score = 21.2 bits (43), Expect(2) = 1e-08 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 188 SNIFTIDVGGXXXXXXXXXXXQSGPDSILSK 96 S+I +IDVGG +GP + S+ Sbjct: 17 SDIVSIDVGGQLFQTTKQTLTSAGPKTFFSR 47 >ref|XP_002509821.1| potassium channel tetramerization domain-containing protein, putative [Ricinus communis] gi|223549720|gb|EEF51208.1| potassium channel tetramerization domain-containing protein, putative [Ricinus communis] Length = 474 Score = 57.0 bits (136), Expect(2) = 2e-08 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -2 Query: 118 ALILFYLRTGNLPSKAKAFDLQDLVFEAKFYGIEELLVN 2 +++L LRTGNLPSKAK FD++DL+ E+KFY IE LL+N Sbjct: 76 SVMLSLLRTGNLPSKAKGFDIEDLIAESKFYNIESLLIN 114 Score = 26.6 bits (57), Expect(2) = 2e-08 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -1 Query: 197 SSSSNIFTIDVGGXXXXXXXXXXXQSGPDSILSK 96 S S I TIDVGG SGP S+ S+ Sbjct: 23 SPQSEIITIDVGGQIFQTTKQTLSLSGPKSLFSQ 56