BLASTX nr result
ID: Cnidium21_contig00044472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00044472 (454 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520560.1| Rho GDP-dissociation inhibitor, putative [Ri... 73 3e-11 ref|XP_002532283.1| Rho GDP-dissociation inhibitor, putative [Ri... 72 6e-11 ref|XP_004134795.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 71 1e-10 ref|XP_002268608.2| PREDICTED: rho GDP-dissociation inhibitor 1-... 70 1e-10 ref|XP_003518574.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 70 1e-10 >ref|XP_002520560.1| Rho GDP-dissociation inhibitor, putative [Ricinus communis] gi|223540220|gb|EEF41793.1| Rho GDP-dissociation inhibitor, putative [Ricinus communis] Length = 243 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +2 Query: 2 FARGSYTAKSKFLDDDDKCYLEINYTFDIRKEWQS 106 FARGSY+A+SKF+DDD+KCYLEINYTFDIRKEWQS Sbjct: 208 FARGSYSARSKFVDDDNKCYLEINYTFDIRKEWQS 242 >ref|XP_002532283.1| Rho GDP-dissociation inhibitor, putative [Ricinus communis] gi|223528017|gb|EEF30098.1| Rho GDP-dissociation inhibitor, putative [Ricinus communis] Length = 246 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 2 FARGSYTAKSKFLDDDDKCYLEINYTFDIRKEW 100 FARGSY+AKSKFLDDD+KCYLEINYTFDIRKEW Sbjct: 211 FARGSYSAKSKFLDDDNKCYLEINYTFDIRKEW 243 >ref|XP_004134795.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Cucumis sativus] gi|449516309|ref|XP_004165189.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Cucumis sativus] Length = 233 Score = 70.9 bits (172), Expect = 1e-10 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = +2 Query: 2 FARGSYTAKSKFLDDDDKCYLEINYTFDIRKEWQS 106 FARGSY+A++KF+DDDDKCYLE NYTFDIRK+WQS Sbjct: 198 FARGSYSARTKFVDDDDKCYLEFNYTFDIRKDWQS 232 >ref|XP_002268608.2| PREDICTED: rho GDP-dissociation inhibitor 1-like [Vitis vinifera] Length = 205 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 2 FARGSYTAKSKFLDDDDKCYLEINYTFDIRKEW 100 FARGSY+A+SKFLDDD+KCYLEINYTFDIRKEW Sbjct: 170 FARGSYSARSKFLDDDNKCYLEINYTFDIRKEW 202 >ref|XP_003518574.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Glycine max] Length = 233 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 2 FARGSYTAKSKFLDDDDKCYLEINYTFDIRKEW 100 FARGSY+A+SKFLDDD+KCYLEINYTFDIRKEW Sbjct: 200 FARGSYSARSKFLDDDNKCYLEINYTFDIRKEW 232