BLASTX nr result
ID: Cnidium21_contig00044250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00044250 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284730.2| PREDICTED: uncharacterized protein LOC100259... 62 5e-08 emb|CAN81981.1| hypothetical protein VITISV_042629 [Vitis vinifera] 62 5e-08 emb|CBI36769.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_002319019.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_002512377.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 >ref|XP_002284730.2| PREDICTED: uncharacterized protein LOC100259649 [Vitis vinifera] Length = 357 Score = 62.0 bits (149), Expect = 5e-08 Identities = 35/55 (63%), Positives = 42/55 (76%), Gaps = 2/55 (3%) Frame = -2 Query: 332 RRSFSPSRLANKLVSPLRSRKSVNNIEGAKMMMSGLKQRPSFSI--PMQFSSRRI 174 RRSFSPSRLAN+LVSPL++RK V +G MMMSGLKQRP+ S+ P + S RI Sbjct: 304 RRSFSPSRLANRLVSPLKNRKCVQKSDGL-MMMSGLKQRPASSLVMPTRLSVERI 357 >emb|CAN81981.1| hypothetical protein VITISV_042629 [Vitis vinifera] Length = 1239 Score = 62.0 bits (149), Expect = 5e-08 Identities = 35/55 (63%), Positives = 42/55 (76%), Gaps = 2/55 (3%) Frame = -2 Query: 332 RRSFSPSRLANKLVSPLRSRKSVNNIEGAKMMMSGLKQRPSFSI--PMQFSSRRI 174 RRSFSPSRLAN+LVSPL++RK V +G MMMSGLKQRP+ S+ P + S RI Sbjct: 1186 RRSFSPSRLANRLVSPLKNRKCVQKSDGL-MMMSGLKQRPASSLVMPTRLSVERI 1239 >emb|CBI36769.3| unnamed protein product [Vitis vinifera] Length = 352 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -2 Query: 332 RRSFSPSRLANKLVSPLRSRKSVNNIEGAKMMMSGLKQRPSFSI 201 RRSFSPSRLAN+LVSPL++RK V +G MMMSGLKQRP+ S+ Sbjct: 304 RRSFSPSRLANRLVSPLKNRKCVQKSDGL-MMMSGLKQRPASSL 346 >ref|XP_002319019.1| predicted protein [Populus trichocarpa] gi|222857395|gb|EEE94942.1| predicted protein [Populus trichocarpa] Length = 370 Score = 58.9 bits (141), Expect = 4e-07 Identities = 34/54 (62%), Positives = 41/54 (75%) Frame = -2 Query: 335 VRRSFSPSRLANKLVSPLRSRKSVNNIEGAKMMMSGLKQRPSFSIPMQFSSRRI 174 +RRSFSPSRLANKLVSPL+ RK V +G ++MSGLKQRP + P +FS RI Sbjct: 320 LRRSFSPSRLANKLVSPLKGRKIVLKSDG--LIMSGLKQRP-IATPRRFSLGRI 370 >ref|XP_002512377.1| conserved hypothetical protein [Ricinus communis] gi|223548338|gb|EEF49829.1| conserved hypothetical protein [Ricinus communis] Length = 359 Score = 58.2 bits (139), Expect = 7e-07 Identities = 32/53 (60%), Positives = 43/53 (81%) Frame = -2 Query: 335 VRRSFSPSRLANKLVSPLRSRKSVNNIEGAKMMMSGLKQRPSFSIPMQFSSRR 177 +RRSFSPSRLAN+LVSPL++RKS +++ +MSGLKQRP+ S+P +FS R Sbjct: 309 LRRSFSPSRLANRLVSPLKTRKS--SVQKTDGLMSGLKQRPA-SMPRRFSLGR 358