BLASTX nr result
ID: Cnidium21_contig00043958
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00043958 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276426.1| PREDICTED: uncharacterized protein LOC100253... 55 8e-06 >ref|XP_002276426.1| PREDICTED: uncharacterized protein LOC100253147 [Vitis vinifera] gi|147801393|emb|CAN74736.1| hypothetical protein VITISV_044236 [Vitis vinifera] gi|296082236|emb|CBI21241.3| unnamed protein product [Vitis vinifera] Length = 187 Score = 54.7 bits (130), Expect = 8e-06 Identities = 33/66 (50%), Positives = 46/66 (69%), Gaps = 3/66 (4%) Frame = -2 Query: 239 KMNASGFLKKILSI---VRKAKSIADLKNRMRKIKTRFMIYSLLSTDKKVLFGSISHKIQ 69 K AS FLK+I+S+ V KAKS+A LK++ +KTR +++SLL +KKVL SISHK+ Sbjct: 2 KNKASSFLKQIISVITTVAKAKSLA-LKSKTSALKTRLLVFSLLR-NKKVLMASISHKLH 59 Query: 68 GLIQDQ 51 L+ Q Sbjct: 60 ALVGQQ 65