BLASTX nr result
ID: Cnidium21_contig00043930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00043930 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_02919177.1| hypothetical protein STRINF_00001 [Streptococ... 88 6e-16 ref|ZP_17548025.1| hypothetical protein II7_05001 [Bacillus cere... 87 2e-15 ref|ZP_00235696.1| hypothetical protein [Bacillus cereus G9241] ... 87 2e-15 ref|ZP_04287638.1| hypothetical protein bcere0009_4300 [Bacillus... 86 2e-15 ref|ZP_00241370.1| hypothetical protein BCE_G9241_4987 [Bacillus... 86 3e-15 >ref|ZP_02919177.1| hypothetical protein STRINF_00001 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] gi|171283277|gb|EDT48701.1| hypothetical protein STRINF_00001 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] Length = 92 Score = 88.2 bits (217), Expect = 6e-16 Identities = 50/89 (56%), Positives = 62/89 (69%), Gaps = 1/89 (1%) Frame = -2 Query: 286 SVLQPYEASFIVWAIPVSLAATQGIEFSFSSCNYLDVSVHCVFLLIAMYSQTSKYPLRYL 107 +VLQP + V + +SLAAT+ I F+FSSC+YLDVSVHCVFL I + T + Y+ Sbjct: 6 AVLQPRCVNTSVCPLAISLAATKAIAFAFSSCSYLDVSVHCVFLFITL---TVMSDMHYM 62 Query: 106 -GSPIRKSPDQSLLTAPRGVSSLVTSFIG 23 GSPIR S D LTAP+ +SSLVTSFIG Sbjct: 63 PGSPIRTSLDHCSLTAPQSISSLVTSFIG 91 >ref|ZP_17548025.1| hypothetical protein II7_05001 [Bacillus cereus MSX-A12] gi|401199382|gb|EJR06284.1| hypothetical protein II7_05001 [Bacillus cereus MSX-A12] Length = 143 Score = 86.7 bits (213), Expect = 2e-15 Identities = 56/105 (53%), Positives = 62/105 (59%), Gaps = 7/105 (6%) Frame = -2 Query: 313 LSLPFVLTTSVLQPYEASF-----IVW--AIPVSLAATQGIEFSFSSCNYLDVSVHCVFL 155 LS L S + PY S+ W VSLAATQ I F+FSS YLDVSV V L Sbjct: 39 LSRSLRLPRSFVTPYRMSYNPKRQASWFGLCSVSLAATQEIAFAFSSSRYLDVSVPWVCL 98 Query: 154 LIAMYSQTSKYPLRYLGSPIRKSPDQSLLTAPRGVSSLVTSFIGS 20 MYS PLR +G PIRKS DQSLLTAPR +S+LV SFI S Sbjct: 99 PYPMYSDKDTIPLRIVGFPIRKSSDQSLLTAPRSISALVPSFIDS 143 >ref|ZP_00235696.1| hypothetical protein [Bacillus cereus G9241] gi|47567098|ref|ZP_00237814.1| hypothetical protein BCE_G9241_0494 [Bacillus cereus G9241] gi|47567496|ref|ZP_00238208.1| hypothetical protein [Bacillus cereus G9241] gi|47567513|ref|ZP_00238225.1| hypothetical protein [Bacillus cereus G9241] gi|47568853|ref|ZP_00239547.1| hypothetical protein BCE_G9241_0705 [Bacillus cereus G9241] gi|47569811|ref|ZP_00240481.1| hypothetical protein BCE_G9241_0077 [Bacillus cereus G9241] gi|47569812|ref|ZP_00240482.1| hypothetical protein BCE_G9241_0078 [Bacillus cereus G9241] gi|47570655|ref|ZP_00241262.1| hypothetical protein BCE_G9241_4986 [Bacillus cereus G9241] gi|49476763|ref|YP_034602.1| hypothetical protein BT9727_0250 [Bacillus thuringiensis serovar konkukian str. 97-27] gi|228918368|ref|ZP_04081832.1| hypothetical protein bthur0012_55170 [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] gi|228956324|ref|ZP_04118166.1| hypothetical protein bthur0006_55920 [Bacillus thuringiensis serovar kurstaki str. T03a001] gi|228961961|ref|ZP_04123494.1| hypothetical protein bthur0005_53600 [Bacillus thuringiensis serovar pakistani str. T13001] gi|228989207|ref|ZP_04149212.1| hypothetical protein bthur0001_58120 [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] gi|229082789|ref|ZP_04215225.1| hypothetical protein bcere0023_53890 [Bacillus cereus Rock4-2] gi|229182367|ref|ZP_04309635.1| hypothetical protein bcere0005_56710 [Bacillus cereus 172560W] gi|229187888|ref|ZP_04315001.1| hypothetical protein bcere0004_54090 [Bacillus cereus BGSC 6E1] gi|229193836|ref|ZP_04320761.1| hypothetical protein bcere0002_54650 [Bacillus cereus ATCC 10876] gi|365164241|ref|ZP_09360311.1| hypothetical protein HMPREF1014_05774 [Bacillus sp. 7_6_55CFAA_CT2] gi|423422385|ref|ZP_17399416.1| hypothetical protein IE5_00074 [Bacillus cereus BAG3X2-2] gi|423439649|ref|ZP_17416576.1| hypothetical protein IE9_05776 [Bacillus cereus BAG4X12-1] gi|423591098|ref|ZP_17567151.1| hypothetical protein IIE_06476 [Bacillus cereus VD045] gi|423632061|ref|ZP_17607807.1| hypothetical protein IK5_04910 [Bacillus cereus VD154] gi|47552677|gb|EAL11121.1| unknown [Bacillus cereus G9241] gi|47553504|gb|EAL11885.1| unknown [Bacillus cereus G9241] gi|47553505|gb|EAL11886.1| unknown [Bacillus cereus G9241] gi|47554529|gb|EAL12886.1| unknown [Bacillus cereus G9241] gi|47555898|gb|EAL14237.1| unknown [Bacillus cereus G9241] gi|47555915|gb|EAL14254.1| unknown [Bacillus cereus G9241] gi|47556154|gb|EAL14489.1| unknown [Bacillus cereus G9241] gi|47558025|gb|EAL16349.1| unknown [Bacillus cereus G9241] gi|49328319|gb|AAT58965.1| conserved hypothetical protein [Bacillus thuringiensis serovar konkukian str. 97-27] gi|221237826|gb|ACM10536.1| conserved hypothetical protein [Bacillus cereus Q1] gi|221237844|gb|ACM10554.1| conserved hypothetical protein [Bacillus cereus Q1] gi|221237896|gb|ACM10606.1| conserved hypothetical protein [Bacillus cereus Q1] gi|221237970|gb|ACM10680.1| conserved hypothetical protein [Bacillus cereus Q1] gi|221238066|gb|ACM10776.1| conserved hypothetical protein [Bacillus cereus Q1] gi|221238080|gb|ACM10790.1| conserved hypothetical protein [Bacillus cereus Q1] gi|221238083|gb|ACM10793.1| conserved hypothetical protein [Bacillus cereus Q1] gi|221238091|gb|ACM10801.1| conserved hypothetical protein [Bacillus cereus Q1] gi|221238094|gb|ACM10804.1| conserved hypothetical protein [Bacillus cereus Q1] gi|221238101|gb|ACM10811.1| conserved hypothetical protein [Bacillus cereus Q1] gi|221238329|gb|ACM11039.1| conserved hypothetical protein [Bacillus cereus Q1] gi|221238532|gb|ACM11242.1| conserved hypothetical protein [Bacillus cereus Q1] gi|221242406|gb|ACM15116.1| conserved hypothetical protein [Bacillus cereus Q1] gi|228589639|gb|EEK47533.1| hypothetical protein bcere0002_54650 [Bacillus cereus ATCC 10876] gi|228595586|gb|EEK53293.1| hypothetical protein bcere0004_54090 [Bacillus cereus BGSC 6E1] gi|228601106|gb|EEK58659.1| hypothetical protein bcere0005_56710 [Bacillus cereus 172560W] gi|228700520|gb|EEL53070.1| hypothetical protein bcere0023_53890 [Bacillus cereus Rock4-2] gi|228770524|gb|EEM19084.1| hypothetical protein bthur0001_58120 [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] gi|228797722|gb|EEM44802.1| hypothetical protein bthur0005_53600 [Bacillus thuringiensis serovar pakistani str. T13001] gi|228803353|gb|EEM50130.1| hypothetical protein bthur0006_55920 [Bacillus thuringiensis serovar kurstaki str. T03a001] gi|228841286|gb|EEM86464.1| hypothetical protein bthur0012_55170 [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] gi|363612177|gb|EHL63729.1| hypothetical protein HMPREF1014_05774 [Bacillus sp. 7_6_55CFAA_CT2] gi|401111307|gb|EJQ19205.1| hypothetical protein IE9_05776 [Bacillus cereus BAG4X12-1] gi|401120102|gb|EJQ27903.1| hypothetical protein IE5_00074 [Bacillus cereus BAG3X2-2] gi|401217170|gb|EJR23867.1| hypothetical protein IIE_06476 [Bacillus cereus VD045] gi|401262780|gb|EJR68918.1| hypothetical protein IK5_04910 [Bacillus cereus VD154] Length = 143 Score = 86.7 bits (213), Expect = 2e-15 Identities = 56/105 (53%), Positives = 62/105 (59%), Gaps = 7/105 (6%) Frame = -2 Query: 313 LSLPFVLTTSVLQPYEASF-----IVW--AIPVSLAATQGIEFSFSSCNYLDVSVHCVFL 155 LS L S + PY S+ W VSLAATQ I F+FSS YLDVSV V L Sbjct: 39 LSRSLRLPRSFVTPYRMSYNPKRQASWFGLCSVSLAATQEIAFAFSSSRYLDVSVPWVCL 98 Query: 154 LIAMYSQTSKYPLRYLGSPIRKSPDQSLLTAPRGVSSLVTSFIGS 20 MYS PLR +G PIRKS DQSLLTAPR +S+LV SFI S Sbjct: 99 PYPMYSDKDTIPLRMVGFPIRKSSDQSLLTAPRSISALVPSFIDS 143 >ref|ZP_04287638.1| hypothetical protein bcere0009_4300 [Bacillus cereus R309803] gi|228623843|gb|EEK80656.1| hypothetical protein bcere0009_4300 [Bacillus cereus R309803] Length = 143 Score = 86.3 bits (212), Expect = 2e-15 Identities = 56/105 (53%), Positives = 62/105 (59%), Gaps = 7/105 (6%) Frame = -2 Query: 313 LSLPFVLTTSVLQPYEASF-----IVW--AIPVSLAATQGIEFSFSSCNYLDVSVHCVFL 155 LS L S + PY S+ W VSLAATQ I F+FSS YLDVSV V L Sbjct: 39 LSRSLRLPHSFVTPYRMSYNPKRQASWFGLCSVSLAATQEIAFAFSSSRYLDVSVPWVCL 98 Query: 154 LIAMYSQTSKYPLRYLGSPIRKSPDQSLLTAPRGVSSLVTSFIGS 20 MYS PLR +G PIRKS DQSLLTAPR +S+LV SFI S Sbjct: 99 PYPMYSDKDTIPLRMVGFPIRKSSDQSLLTAPRSISALVPSFIDS 143 >ref|ZP_00241370.1| hypothetical protein BCE_G9241_4987 [Bacillus cereus G9241] gi|229176340|ref|ZP_04303797.1| hypothetical protein bcere0006_53810 [Bacillus cereus MM3] gi|47552514|gb|EAL11015.1| unknown [Bacillus cereus G9241] gi|228607132|gb|EEK64497.1| hypothetical protein bcere0006_53810 [Bacillus cereus MM3] Length = 143 Score = 85.9 bits (211), Expect = 3e-15 Identities = 56/105 (53%), Positives = 62/105 (59%), Gaps = 7/105 (6%) Frame = -2 Query: 313 LSLPFVLTTSVLQPYEASF-----IVW--AIPVSLAATQGIEFSFSSCNYLDVSVHCVFL 155 LS L S + PY S+ W VSLAATQ I F+FSS YLDVSV V L Sbjct: 39 LSRSLRLPRSFVTPYRMSYNPKRQASWFGLCSVSLAATQEIAFAFSSSRYLDVSVPWVCL 98 Query: 154 LIAMYSQTSKYPLRYLGSPIRKSPDQSLLTAPRGVSSLVTSFIGS 20 MYS PLR +G PIRKS DQSLLTAPR +S+LV SFI S Sbjct: 99 PYPMYSGKDTIPLRMVGFPIRKSSDQSLLTAPRSISALVPSFIDS 143