BLASTX nr result
ID: Cnidium21_contig00043802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00043802 (395 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308232.1| predicted protein [Populus trichocarpa] gi|2... 78 6e-13 ref|XP_003604571.1| Gamma-interferon-inducible lysosomal thiol r... 76 2e-12 ref|XP_003604570.1| Gamma-interferon-inducible lysosomal thiol r... 75 5e-12 ref|NP_567395.1| Gamma interferon responsive lysosomal thiol (GI... 75 7e-12 gb|AAM65025.1| unknown [Arabidopsis thaliana] 75 7e-12 >ref|XP_002308232.1| predicted protein [Populus trichocarpa] gi|222854208|gb|EEE91755.1| predicted protein [Populus trichocarpa] Length = 260 Score = 78.2 bits (191), Expect = 6e-13 Identities = 33/54 (61%), Positives = 43/54 (79%) Frame = +1 Query: 220 DAAPNNYTKVNVSLYFESLCPFCGNFIVNQLGKVFETDLISIVNLRLVPWGNAH 381 D++ N KVN+S+Y+E+LCP C NFIV L +VF DLI+I+NLR+VPWGNAH Sbjct: 36 DSSSINRQKVNLSVYYEALCPSCANFIVQSLARVFNDDLINIINLRMVPWGNAH 89 >ref|XP_003604571.1| Gamma-interferon-inducible lysosomal thiol reductase [Medicago truncatula] gi|355505626|gb|AES86768.1| Gamma-interferon-inducible lysosomal thiol reductase [Medicago truncatula] Length = 261 Score = 76.3 bits (186), Expect = 2e-12 Identities = 34/59 (57%), Positives = 45/59 (76%) Frame = +1 Query: 217 SDAAPNNYTKVNVSLYFESLCPFCGNFIVNQLGKVFETDLISIVNLRLVPWGNAHRVTN 393 S + N KV +S+Y+ESLCP+ +FIVN L K+F+T+LISIVNL++VPWGNA TN Sbjct: 35 SSTSSKNEKKVTMSIYYESLCPYSADFIVNHLVKLFQTNLISIVNLKMVPWGNARIATN 93 >ref|XP_003604570.1| Gamma-interferon-inducible lysosomal thiol reductase [Medicago truncatula] gi|355505625|gb|AES86767.1| Gamma-interferon-inducible lysosomal thiol reductase [Medicago truncatula] Length = 351 Score = 75.1 bits (183), Expect = 5e-12 Identities = 34/55 (61%), Positives = 46/55 (83%), Gaps = 1/55 (1%) Frame = +1 Query: 217 SDAAPNNYTK-VNVSLYFESLCPFCGNFIVNQLGKVFETDLISIVNLRLVPWGNA 378 S ++ +NY K V +S+Y+ESLCPFC +FIVN L ++F+T LISIV+LR+VPWGNA Sbjct: 36 SSSSSSNYDKKVTMSIYYESLCPFCADFIVNDLVRLFQTGLISIVDLRMVPWGNA 90 >ref|NP_567395.1| Gamma interferon responsive lysosomal thiol (GILT) reductase family protein [Arabidopsis thaliana] gi|111074290|gb|ABH04518.1| At4g12890 [Arabidopsis thaliana] gi|332657800|gb|AEE83200.1| Gamma interferon responsive lysosomal thiol (GILT) reductase family protein [Arabidopsis thaliana] Length = 232 Score = 74.7 bits (182), Expect = 7e-12 Identities = 31/53 (58%), Positives = 43/53 (81%) Frame = +1 Query: 235 NYTKVNVSLYFESLCPFCGNFIVNQLGKVFETDLISIVNLRLVPWGNAHRVTN 393 N KV ++LY+ESLCP+C NFIV+ LGK+F++DL+ I +L+LVP+GNAH N Sbjct: 35 NSNKVKINLYYESLCPYCQNFIVDDLGKIFDSDLLKITDLKLVPFGNAHISNN 87 >gb|AAM65025.1| unknown [Arabidopsis thaliana] Length = 232 Score = 74.7 bits (182), Expect = 7e-12 Identities = 31/53 (58%), Positives = 43/53 (81%) Frame = +1 Query: 235 NYTKVNVSLYFESLCPFCGNFIVNQLGKVFETDLISIVNLRLVPWGNAHRVTN 393 N KV ++LY+ESLCP+C NFIV+ LGK+F++DL+ I +L+LVP+GNAH N Sbjct: 35 NSNKVKINLYYESLCPYCQNFIVDDLGKIFDSDLLKITDLKLVPFGNAHISNN 87