BLASTX nr result
ID: Cnidium21_contig00043767
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00043767 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533135.1| conserved hypothetical protein [Ricinus comm... 78 9e-13 gb|ADD09595.1| bZIP transcription factor [Trifolium repens] 77 1e-12 gb|ADD09617.1| bZIP transcription factor [Trifolium repens] 77 2e-12 ref|XP_003532833.1| PREDICTED: uncharacterized protein LOC100789... 76 3e-12 ref|XP_004168010.1| PREDICTED: uncharacterized LOC101210456 [Cuc... 74 1e-11 >ref|XP_002533135.1| conserved hypothetical protein [Ricinus communis] gi|223527063|gb|EEF29247.1| conserved hypothetical protein [Ricinus communis] Length = 749 Score = 77.8 bits (190), Expect = 9e-13 Identities = 36/48 (75%), Positives = 44/48 (91%) Frame = +3 Query: 186 MGATSSKAERSEALRLCKERKRFIKRAIDSRYNFAASHVAYIQSLKNI 329 MG+TSSKA++ +ALRLCKER+R IK+AIDSRYN AA+HV+YI SLKNI Sbjct: 1 MGSTSSKAQKDDALRLCKERRRLIKQAIDSRYNLAAAHVSYISSLKNI 48 >gb|ADD09595.1| bZIP transcription factor [Trifolium repens] Length = 663 Score = 77.0 bits (188), Expect = 1e-12 Identities = 36/48 (75%), Positives = 44/48 (91%) Frame = +3 Query: 186 MGATSSKAERSEALRLCKERKRFIKRAIDSRYNFAASHVAYIQSLKNI 329 MGAT+SKAE++EAL LCKERKRFIK AIDSRY+ AA+H +YIQSL+N+ Sbjct: 1 MGATNSKAEKNEALSLCKERKRFIKVAIDSRYDLAAAHTSYIQSLRNV 48 >gb|ADD09617.1| bZIP transcription factor [Trifolium repens] Length = 663 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/48 (72%), Positives = 44/48 (91%) Frame = +3 Query: 186 MGATSSKAERSEALRLCKERKRFIKRAIDSRYNFAASHVAYIQSLKNI 329 MGAT+SK E++EAL LCKERKRFIK AIDSRY+ AA+H++YIQSL+N+ Sbjct: 1 MGATNSKGEKNEALSLCKERKRFIKVAIDSRYDLAAAHISYIQSLRNV 48 >ref|XP_003532833.1| PREDICTED: uncharacterized protein LOC100789264 [Glycine max] Length = 697 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/48 (72%), Positives = 44/48 (91%) Frame = +3 Query: 186 MGATSSKAERSEALRLCKERKRFIKRAIDSRYNFAASHVAYIQSLKNI 329 MGAT+S+AE++EAL LCKERKRF+K AIDSRY AA+HV+YIQSL+N+ Sbjct: 1 MGATNSRAEKNEALSLCKERKRFVKVAIDSRYALAAAHVSYIQSLRNV 48 >ref|XP_004168010.1| PREDICTED: uncharacterized LOC101210456 [Cucumis sativus] Length = 715 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/48 (68%), Positives = 42/48 (87%) Frame = +3 Query: 186 MGATSSKAERSEALRLCKERKRFIKRAIDSRYNFAASHVAYIQSLKNI 329 MG T+SK E +EALRLCKERKR+IK+AIDSRY AA+HV Y+Q+L+N+ Sbjct: 1 MGGTNSKIENNEALRLCKERKRYIKQAIDSRYALAAAHVCYVQALRNV 48