BLASTX nr result
ID: Cnidium21_contig00043694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00043694 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEC82986.1| hypothetical protein OsI_28021 [Oryza sativa Indi... 50 5e-06 >gb|EEC82986.1| hypothetical protein OsI_28021 [Oryza sativa Indica Group] Length = 937 Score = 49.7 bits (117), Expect(2) = 5e-06 Identities = 21/60 (35%), Positives = 32/60 (53%) Frame = -2 Query: 257 SDDENEAGVLHQDLWAEYMDLGKLDKICLKCKALMWNEERNNKSVKYHSPTFSLCCRNGK 78 S + ++H +W + GK IC C AL+W EER N + +P+F +CC+ GK Sbjct: 77 SSSSTPSTIVHSQIW----NFGKPTYICQHCNALLWYEERLNSNKSTTNPSFGMCCKQGK 132 Score = 25.4 bits (54), Expect(2) = 5e-06 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 Query: 81 QVKLPEERQPPQSLASLLSG 22 ++KLP ++PPQ L LL+G Sbjct: 132 KIKLPPLKEPPQYLKRLLTG 151