BLASTX nr result
ID: Cnidium21_contig00043566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00043566 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_192429.1| cysteine-rich receptor-like protein kinase 25 [... 62 6e-08 ref|XP_003638035.1| Cysteine-rich receptor-like protein kinase [... 60 1e-07 ref|XP_003637976.1| Cysteine-rich receptor-like protein kinase [... 60 1e-07 ref|NP_001238492.1| cysteine-rich protein precursor [Glycine max... 60 1e-07 ref|XP_002518553.1| ATP binding protein, putative [Ricinus commu... 60 1e-07 >ref|NP_192429.1| cysteine-rich receptor-like protein kinase 25 [Arabidopsis thaliana] gi|75335771|sp|Q9M0X5.1|CRK25_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 25; Short=Cysteine-rich RLK25; Flags: Precursor gi|7267280|emb|CAB81062.1| receptor protein kinase-like protein [Arabidopsis thaliana] gi|332657090|gb|AEE82490.1| cysteine-rich receptor-like protein kinase 25 [Arabidopsis thaliana] Length = 675 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/67 (46%), Positives = 38/67 (56%), Gaps = 5/67 (7%) Frame = -1 Query: 297 PELPEAACRRCLRVAINYL-QYHNNSQGGRTLVASCTVRYELYPFYRNIAT----APPPS 133 P+L C CLR INYL + + S GGR + SC+ RYELYPFY APPPS Sbjct: 203 PDLTNQDCESCLRQVINYLPRCCDRSVGGRVIAPSCSFRYELYPFYNETIAAAPMAPPPS 262 Query: 132 QVMNSPP 112 + +PP Sbjct: 263 STVTAPP 269 >ref|XP_003638035.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355503970|gb|AES85173.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 657 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/55 (54%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = -1 Query: 294 ELPEAACRRCLRVAINYL-QYHNNSQGGRTLVASCTVRYELYPFYRNIATAPPPS 133 +L + CR CL AI L Q + QGGR L SC VRYELYPFYRN+A +P P+ Sbjct: 205 DLSQQDCRTCLSDAIGALPQCCDGKQGGRVLFPSCNVRYELYPFYRNLAPSPSPA 259 >ref|XP_003637976.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355503911|gb|AES85114.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 661 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/55 (54%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = -1 Query: 294 ELPEAACRRCLRVAINYL-QYHNNSQGGRTLVASCTVRYELYPFYRNIATAPPPS 133 +L + CR CL AI L Q + QGGR L SC VRYELYPFYRN+A +P P+ Sbjct: 209 DLSQQDCRTCLSDAIGALPQCCDGKQGGRVLFPSCNVRYELYPFYRNLAPSPSPA 263 >ref|NP_001238492.1| cysteine-rich protein precursor [Glycine max] gi|223452302|gb|ACM89479.1| cysteine-rich protein [Glycine max] Length = 667 Score = 60.5 bits (145), Expect = 1e-07 Identities = 36/71 (50%), Positives = 40/71 (56%), Gaps = 1/71 (1%) Frame = -1 Query: 297 PELPEAACRRCLRVAINYLQYH-NNSQGGRTLVASCTVRYELYPFYRNIATAPPPSQVMN 121 P+L + CR CL I L + QGGR L SC VRYELYPFYR TA PPS Sbjct: 203 PDLSQENCRSCLSGVIGDLPWCCQGKQGGRVLYPSCNVRYELYPFYR--VTASPPSS-SP 259 Query: 120 SPPTRSADPSS 88 SPPT P+S Sbjct: 260 SPPTLLPPPTS 270 >ref|XP_002518553.1| ATP binding protein, putative [Ricinus communis] gi|223542398|gb|EEF43940.1| ATP binding protein, putative [Ricinus communis] Length = 674 Score = 60.5 bits (145), Expect = 1e-07 Identities = 39/103 (37%), Positives = 51/103 (49%), Gaps = 4/103 (3%) Frame = -1 Query: 297 PELPEAACRRCLRVAINYLQYH-NNSQGGRTLVASCTVRYELYPFYRNIATAPP---PSQ 130 P+L C RCL+ AI+ L + +GGR L SC +RYE+YPF+ A PP PS Sbjct: 202 PDLSNLDCGRCLQAAISNLPTCCDGKRGGRVLYPSCNIRYEVYPFFNVTALEPPPPSPSP 261 Query: 129 VMNSPPTRSADPSSFDRRXXXXXXXXXXXXXXVAPICVALVFF 1 V+ PPT S + VAP+ VA+VFF Sbjct: 262 VVPPPPTSS---GTRPETKGKSGLSTVTIVAIVAPVAVAIVFF 301