BLASTX nr result
ID: Cnidium21_contig00043522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00043522 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN33746.1| hypothetical protein [Cucumis melo subsp. melo] 57 2e-06 ref|XP_004163848.1| PREDICTED: uncharacterized LOC101206875 [Cuc... 56 3e-06 ref|XP_004146269.1| PREDICTED: uncharacterized protein LOC101206... 56 3e-06 ref|XP_002516655.1| conserved hypothetical protein [Ricinus comm... 54 1e-05 >gb|ADN33746.1| hypothetical protein [Cucumis melo subsp. melo] Length = 817 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/61 (47%), Positives = 36/61 (59%) Frame = +2 Query: 131 MGDEAVSGGLCLVVSEQKTDNSSTVLLGASCALFALRLLLEPNIDDEKWSETRNRVLDGG 310 M DE L +SE+K D+ S + G SCA FALRLL + DEKWSE R ++L G Sbjct: 1 MMDEKEVSNLRTFISEEKIDSLSPMYFGVSCAFFALRLLSTSDCKDEKWSEVREKMLQGS 60 Query: 311 A 313 A Sbjct: 61 A 61 >ref|XP_004163848.1| PREDICTED: uncharacterized LOC101206875 [Cucumis sativus] Length = 818 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/61 (47%), Positives = 38/61 (62%) Frame = +2 Query: 131 MGDEAVSGGLCLVVSEQKTDNSSTVLLGASCALFALRLLLEPNIDDEKWSETRNRVLDGG 310 M ++ VS L + SE+K D+ S + G SCA FALRLL + DEKWSE R ++L G Sbjct: 2 MDEKEVSNSLTFI-SEEKIDSLSPMYFGVSCAFFALRLLSTSDCKDEKWSEVREKMLQGS 60 Query: 311 A 313 A Sbjct: 61 A 61 >ref|XP_004146269.1| PREDICTED: uncharacterized protein LOC101206875 [Cucumis sativus] Length = 808 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/61 (47%), Positives = 38/61 (62%) Frame = +2 Query: 131 MGDEAVSGGLCLVVSEQKTDNSSTVLLGASCALFALRLLLEPNIDDEKWSETRNRVLDGG 310 M ++ VS L + SE+K D+ S + G SCA FALRLL + DEKWSE R ++L G Sbjct: 2 MDEKEVSNSLTFI-SEEKIDSLSPMYFGVSCAFFALRLLSTSDCKDEKWSEVREKMLQGS 60 Query: 311 A 313 A Sbjct: 61 A 61 >ref|XP_002516655.1| conserved hypothetical protein [Ricinus communis] gi|223544150|gb|EEF45674.1| conserved hypothetical protein [Ricinus communis] Length = 771 Score = 54.3 bits (129), Expect = 1e-05 Identities = 27/59 (45%), Positives = 38/59 (64%) Frame = +2 Query: 137 DEAVSGGLCLVVSEQKTDNSSTVLLGASCALFALRLLLEPNIDDEKWSETRNRVLDGGA 313 DE G L+VSE KTD+ + G SCAL AL++L +P+ DD+KW E +++L G A Sbjct: 2 DEKRVSGSYLIVSEGKTDSFYPMYFGVSCALCALKVLTKPHKDDDKWVELCDKMLQGSA 60