BLASTX nr result
ID: Cnidium21_contig00043369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00043369 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511276.1| protein binding protein, putative [Ricinus c... 82 3e-14 ref|XP_002318693.1| predicted protein [Populus trichocarpa] gi|2... 80 1e-13 ref|XP_003549831.1| PREDICTED: BTB/POZ and TAZ domain-containing... 79 3e-13 ref|NP_201121.1| BTB and TAZ domain protein 1 [Arabidopsis thali... 77 1e-12 emb|CBI14900.3| unnamed protein product [Vitis vinifera] 77 1e-12 >ref|XP_002511276.1| protein binding protein, putative [Ricinus communis] gi|223550391|gb|EEF51878.1| protein binding protein, putative [Ricinus communis] Length = 363 Score = 82.4 bits (202), Expect = 3e-14 Identities = 42/60 (70%), Positives = 50/60 (83%) Frame = +3 Query: 90 EPDVQIISSDGTCIPAHASILAAASPVLESILDTPRKHRSSSDKTIQILGVPCDAVSVFV 269 EPDVQI++S G IP H+SILA+ S VLE+I+D PRKHR SS++ I ILGVPCDAVSVFV Sbjct: 33 EPDVQILTSGGLRIPVHSSILASVSSVLENIIDRPRKHR-SSERIIPILGVPCDAVSVFV 91 >ref|XP_002318693.1| predicted protein [Populus trichocarpa] gi|222859366|gb|EEE96913.1| predicted protein [Populus trichocarpa] Length = 364 Score = 80.5 bits (197), Expect = 1e-13 Identities = 40/64 (62%), Positives = 51/64 (79%) Frame = +3 Query: 78 HSSVEPDVQIISSDGTCIPAHASILAAASPVLESILDTPRKHRSSSDKTIQILGVPCDAV 257 +S +PDVQI++S+G IPAH ILA+ SPVLE+I+D P KH SS+K I ILGVPCDAV Sbjct: 30 NSLPKPDVQILTSNGLRIPAHTGILASVSPVLENIIDRPHKHH-SSEKIIPILGVPCDAV 88 Query: 258 SVFV 269 S+F+ Sbjct: 89 SLFI 92 >ref|XP_003549831.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 2-like [Glycine max] Length = 346 Score = 79.3 bits (194), Expect = 3e-13 Identities = 41/60 (68%), Positives = 49/60 (81%) Frame = +3 Query: 90 EPDVQIISSDGTCIPAHASILAAASPVLESILDTPRKHRSSSDKTIQILGVPCDAVSVFV 269 EPDV I +S GT IPAHA ILA+ SPVLE+++D PRKHR SS++ IQI GVPCDAV+ FV Sbjct: 14 EPDVFIHTSHGTRIPAHAPILASMSPVLENLIDRPRKHR-SSERIIQIHGVPCDAVTAFV 72 >ref|NP_201121.1| BTB and TAZ domain protein 1 [Arabidopsis thaliana] gi|75309213|sp|Q9FMK7.1|BT1_ARATH RecName: Full=BTB/POZ and TAZ domain-containing protein 1; AltName: Full=BTB and TAZ domain protein 1 gi|10177297|dbj|BAB10558.1| unnamed protein product [Arabidopsis thaliana] gi|36955895|gb|AAQ87004.1| BTB and TAZ domain protein 1 [Arabidopsis thaliana] gi|38603810|gb|AAR24650.1| At5g63160 [Arabidopsis thaliana] gi|110742799|dbj|BAE99302.1| hypothetical protein [Arabidopsis thaliana] gi|332010329|gb|AED97712.1| BTB and TAZ domain protein 1 [Arabidopsis thaliana] Length = 365 Score = 77.0 bits (188), Expect = 1e-12 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 1/69 (1%) Frame = +3 Query: 66 NVTDHSSVEPDVQIISSDGTCIPAHASILAAASPVLESILDTPRK-HRSSSDKTIQILGV 242 N + VE DV+II+S IPAH+ ILA+ SPVL +I++ PRK H SS K I+ILGV Sbjct: 16 NKISYDLVETDVEIITSGRRSIPAHSGILASVSPVLTNIIEKPRKIHGGSSKKVIKILGV 75 Query: 243 PCDAVSVFV 269 PCDAVSVFV Sbjct: 76 PCDAVSVFV 84 >emb|CBI14900.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 77.0 bits (188), Expect = 1e-12 Identities = 40/60 (66%), Positives = 48/60 (80%) Frame = +3 Query: 90 EPDVQIISSDGTCIPAHASILAAASPVLESILDTPRKHRSSSDKTIQILGVPCDAVSVFV 269 EPDV I++S G IPA+AS+LA+ SPVLE+ILD PRK+R S+K I ILGVPCDAV FV Sbjct: 16 EPDVYIVTSGGLRIPANASVLASVSPVLENILDRPRKYR-RSEKIIPILGVPCDAVLAFV 74