BLASTX nr result
ID: Cnidium21_contig00043256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00043256 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588932.1| hypothetical protein MTR_1g015430 [Medicago ... 94 1e-17 ref|YP_398917.1| hypothetical protein NitoCp121 [Nicotiana tomen... 82 6e-14 ref|XP_002338214.1| predicted protein [Populus trichocarpa] gi|2... 80 2e-13 ref|YP_001109552.1| hypothetical protein Poptr_cp074 [Populus tr... 80 2e-13 ref|XP_002319333.1| predicted protein [Populus trichocarpa] gi|2... 79 5e-13 >ref|XP_003588932.1| hypothetical protein MTR_1g015430 [Medicago truncatula] gi|355477980|gb|AES59183.1| hypothetical protein MTR_1g015430 [Medicago truncatula] Length = 219 Score = 94.0 bits (232), Expect = 1e-17 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = +2 Query: 104 LAREVNHRTYGPTNWERINRFLFGSDSSFPNAAYNSPLYCAPQVCLFP 247 LAR+VNHRTYGP+NW+RIN+FLFGSDSSFPNA YN PLYC+ QVCLFP Sbjct: 126 LARKVNHRTYGPSNWKRINKFLFGSDSSFPNATYNYPLYCSLQVCLFP 173 >ref|YP_398917.1| hypothetical protein NitoCp121 [Nicotiana tomentosiformis] gi|81301638|ref|YP_398933.1| hypothetical protein NitoCp122 [Nicotiana tomentosiformis] gi|351653934|ref|YP_004891660.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653949|ref|YP_004891676.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|76559646|emb|CAJ32484.1| hypothetical protein [Nicotiana tabacum] gi|76559648|emb|CAJ32486.1| hypothetical protein [Nicotiana tabacum] gi|77799619|dbj|BAE46708.1| hypothetical protein [Nicotiana sylvestris] gi|77799635|dbj|BAE46724.1| hypothetical protein [Nicotiana sylvestris] gi|80750981|dbj|BAE48057.1| hypothetical protein [Nicotiana tomentosiformis] gi|80750997|dbj|BAE48073.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453960|gb|AEO95618.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453975|gb|AEO95633.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454070|gb|AEO95727.1| hypothetical protein [synthetic construct] gi|347454085|gb|AEO95742.1| hypothetical protein [synthetic construct] Length = 71 Score = 81.6 bits (200), Expect = 6e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -3 Query: 284 VLSQRLAMVRKKGGTSTLGERSTTESCMLRSGRMNRSRKGIY 159 V+SQRLA VRKKGGTSTLGERSTTESCMLRSGRMNRSRKGIY Sbjct: 30 VISQRLARVRKKGGTSTLGERSTTESCMLRSGRMNRSRKGIY 71 >ref|XP_002338214.1| predicted protein [Populus trichocarpa] gi|222871287|gb|EEF08418.1| predicted protein [Populus trichocarpa] Length = 81 Score = 80.1 bits (196), Expect = 2e-13 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -3 Query: 284 VLSQRLAMVRKKGGTSTLGERSTTESCMLRSGRMNRSRKGIY 159 V+S+RLAMVRKKGGTSTLGERST ESCMLRSGRMNRSRKGIY Sbjct: 40 VISKRLAMVRKKGGTSTLGERSTPESCMLRSGRMNRSRKGIY 81 >ref|YP_001109552.1| hypothetical protein Poptr_cp074 [Populus trichocarpa] gi|134093266|ref|YP_001109567.1| hypothetical protein Poptr_cp089 [Populus trichocarpa] gi|133712113|gb|ABO36756.1| conserved hypothetical protein [Populus trichocarpa] gi|133712128|gb|ABO36771.1| conserved hypothetical protein [Populus trichocarpa] Length = 71 Score = 80.1 bits (196), Expect = 2e-13 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -3 Query: 284 VLSQRLAMVRKKGGTSTLGERSTTESCMLRSGRMNRSRKGIY 159 V+S+RLAMVRKKGGTSTLGERST ESCMLRSGRMNRSRKGIY Sbjct: 30 VISKRLAMVRKKGGTSTLGERSTPESCMLRSGRMNRSRKGIY 71 >ref|XP_002319333.1| predicted protein [Populus trichocarpa] gi|222857709|gb|EEE95256.1| predicted protein [Populus trichocarpa] Length = 71 Score = 78.6 bits (192), Expect = 5e-13 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -3 Query: 284 VLSQRLAMVRKKGGTSTLGERSTTESCMLRSGRMNRSRKGIY 159 V+S+RL MVRKKGGTSTLGERST ESCMLRSGRMNRSRKGIY Sbjct: 30 VISKRLVMVRKKGGTSTLGERSTPESCMLRSGRMNRSRKGIY 71