BLASTX nr result
ID: Cnidium21_contig00043181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00043181 (416 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234654.1| bHLH transcriptional regulator [Solanum lyco... 59 5e-07 gb|AAW22875.1| bHLH transcriptional regulator [Solanum lycopersi... 59 5e-07 >ref|NP_001234654.1| bHLH transcriptional regulator [Solanum lycopersicum] gi|23600383|gb|AAN39037.1|AF437878_1 bHLH transcriptional regulator [Solanum lycopersicum] Length = 297 Score = 58.5 bits (140), Expect = 5e-07 Identities = 36/71 (50%), Positives = 42/71 (59%), Gaps = 2/71 (2%) Frame = +3 Query: 3 NFEQFIALIRGETAEPNVRFCHNFLECDHINGCTIDEQSLNNQFEPGFGVP--YDELNNP 176 NFEQFI LIRGETA+P V FC N+ +C+H+ GC + N QFEP YD Sbjct: 19 NFEQFIELIRGETADPIVNFCPNY-DCEHMTGCF---SAANAQFEPILSSMDFYD----- 69 Query: 177 PITTFPDPGSL 209 TT PDP SL Sbjct: 70 --TTLPDPISL 78 >gb|AAW22875.1| bHLH transcriptional regulator [Solanum lycopersicum] Length = 304 Score = 58.5 bits (140), Expect = 5e-07 Identities = 36/71 (50%), Positives = 42/71 (59%), Gaps = 2/71 (2%) Frame = +3 Query: 3 NFEQFIALIRGETAEPNVRFCHNFLECDHINGCTIDEQSLNNQFEPGFGVP--YDELNNP 176 NFEQFI LIRGETA+P V FC N+ +C+H+ GC + N QFEP YD Sbjct: 26 NFEQFIELIRGETADPIVNFCPNY-DCEHMTGCF---SAANAQFEPILSSMDFYD----- 76 Query: 177 PITTFPDPGSL 209 TT PDP SL Sbjct: 77 --TTLPDPISL 85