BLASTX nr result
ID: Cnidium21_contig00043071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00043071 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_13516101.1| hypothetical protein HMPREF1043_0707 [Strepto... 87 2e-15 ref|NP_738153.1| hypothetical protein CE1543 [Corynebacterium ef... 75 4e-12 ref|ZP_06578098.1| LOW QUALITY PROTEIN: conserved hypothetical p... 63 2e-08 ref|ZP_09103479.1| hypothetical protein DesgiDRAFT_4599 [Desulfo... 59 4e-07 ref|ZP_16174224.1| hypothetical protein B216_09698 [Bifidobacter... 59 5e-07 >ref|ZP_13516101.1| hypothetical protein HMPREF1043_0707 [Streptococcus anginosus subsp. whileyi CCUG 39159] gi|383341230|gb|EID19495.1| hypothetical protein HMPREF1043_0707 [Streptococcus anginosus subsp. whileyi CCUG 39159] Length = 191 Score = 86.7 bits (213), Expect = 2e-15 Identities = 48/80 (60%), Positives = 54/80 (67%) Frame = -3 Query: 311 PKLRGHFAEFLHHDSLDRLGILYLSTSVGLGYGRTRHLAHEAFLDSTGSLTHPQPWAPHH 132 PKLRGHFAEFL+HDSLDRL ILYL+T VGLGYG+ A +AFL S GS HP P Sbjct: 32 PKLRGHFAEFLNHDSLDRLSILYLTTCVGLGYGQFEPHA-DAFLGSIGSPDHP-PCGRPS 89 Query: 131 ASTFTPSGFTYQTVHTLSPG 72 T GFTY+ +TL PG Sbjct: 90 GLRHTAGGFTYRQPYTLRPG 109 >ref|NP_738153.1| hypothetical protein CE1543 [Corynebacterium efficiens YS-314] gi|23493383|dbj|BAC18353.1| conserved hypothetical protein [Corynebacterium efficiens YS-314] Length = 261 Score = 75.5 bits (184), Expect = 4e-12 Identities = 42/80 (52%), Positives = 49/80 (61%), Gaps = 1/80 (1%) Frame = -3 Query: 311 PKLRGHFAEFLHHDSLDRLGILYLSTSVGLGYGRTRHLAHEAFLDSTGSLTHPQPW-APH 135 PKLRGHFAEFL+H S +RL ILYL+T VGLGYG H+A +T P A H Sbjct: 104 PKLRGHFAEFLNHSSPERLSILYLTTCVGLGYGPNMHIARG--FSRQYRITEFTPLRATH 161 Query: 134 HASTFTPSGFTYQTVHTLSP 75 HAS GFT + HTL+P Sbjct: 162 HASNIMRYGFTNTSFHTLTP 181 >ref|ZP_06578098.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291341603|gb|EFE68559.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] Length = 91 Score = 63.2 bits (152), Expect = 2e-08 Identities = 37/71 (52%), Positives = 42/71 (59%) Frame = -3 Query: 230 VGLGYGRTRHLAHEAFLDSTGSLTHPQPWAPHHASTFTPSGFTYQTVHTLSPGQPSPGMS 51 VG GYG + + EAFLDS GS T PQ A H S P GF Y T +TL+PGQP PG+ Sbjct: 1 VGFGYGPPCN-SLEAFLDSIGSSTSPQS-ARHRVSDDVPGGFAYLTSYTLTPGQPPPGLD 58 Query: 50 YLTASLRSLPT 18 L AS PT Sbjct: 59 CLPASPHHSPT 69 >ref|ZP_09103479.1| hypothetical protein DesgiDRAFT_4599 [Desulfotomaculum gibsoniae DSM 7213] gi|355354950|gb|EHG02832.1| hypothetical protein DesgiDRAFT_4599 [Desulfotomaculum gibsoniae DSM 7213] Length = 100 Score = 58.9 bits (141), Expect = 4e-07 Identities = 37/71 (52%), Positives = 43/71 (60%), Gaps = 2/71 (2%) Frame = -3 Query: 311 PKLRGHFAEFLHHDSLDRLGILYLSTSVGLGYGRTRHL--AHEAFLDSTGSLTHPQPWAP 138 PKLRGHFAEFL+ L RL IL T VGL YG HL + E FLDS G+ T +AP Sbjct: 32 PKLRGHFAEFLNEGFLARLRILTPPTCVGLRYG---HLIASLEVFLDSLGAATSLLVFAP 88 Query: 137 HHASTFTPSGF 105 + S F +GF Sbjct: 89 RYLSGFVQAGF 99 >ref|ZP_16174224.1| hypothetical protein B216_09698 [Bifidobacterium bifidum LMG 13195] gi|407076843|gb|EKE49756.1| hypothetical protein B216_09698 [Bifidobacterium bifidum LMG 13195] Length = 38 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -3 Query: 311 PKLRGHFAEFLHHDSLDRLGILYLSTSVGLGYGRTR 204 PK R FAEFL DSLDR GILYL+TSVGLGYGR R Sbjct: 2 PKAREQFAEFLDQDSLDRFGILYLTTSVGLGYGRQR 37