BLASTX nr result
ID: Cnidium21_contig00042986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00042986 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_567242.2| translocase of chloroplast 159 [Arabidopsis tha... 55 4e-06 gb|AAC78265.2| putative chloroplast outer envelope 86-like prote... 55 4e-06 >ref|NP_567242.2| translocase of chloroplast 159 [Arabidopsis thaliana] gi|75100143|sp|O81283.1|TC159_ARATH RecName: Full=Translocase of chloroplast 159, chloroplastic; Short=AtToc159; AltName: Full=159 kDa chloroplast outer envelope protein; AltName: Full=Plastid protein import 2; AltName: Full=Translocase of chloroplast 160, chloroplastic; Short=AtToc160; AltName: Full=Translocase of chloroplast 86, chloroplastic; Short=AtToc86 gi|3193301|gb|AAC19285.1| T14P8.24 [Arabidopsis thaliana] gi|332656782|gb|AEE82182.1| translocase of chloroplast 159 [Arabidopsis thaliana] Length = 1503 Score = 55.5 bits (132), Expect = 4e-06 Identities = 35/73 (47%), Positives = 48/73 (65%) Frame = -2 Query: 220 TGSRLTEEKNMKLEKLRSIIVKFLRLVHRSEMSFDNDSVVDNVLFRMKLMAERQLGQNDQ 41 T L+EE+ KLEKL+S+ VKFLRL+ R S + DS+ VL+R+ L+A RQ G Q Sbjct: 775 TEINLSEEEKQKLEKLQSLRVKFLRLLQRLGHSAE-DSIAAQVLYRLALLAGRQAG---Q 830 Query: 40 LFDLNTAKLIALQ 2 LF L+ AK A++ Sbjct: 831 LFSLDAAKKKAVE 843 >gb|AAC78265.2| putative chloroplast outer envelope 86-like protein [Arabidopsis thaliana] gi|7269011|emb|CAB80744.1| putative chloroplast outer envelope 86-like protein [Arabidopsis thaliana] Length = 865 Score = 55.5 bits (132), Expect = 4e-06 Identities = 35/73 (47%), Positives = 48/73 (65%) Frame = -2 Query: 220 TGSRLTEEKNMKLEKLRSIIVKFLRLVHRSEMSFDNDSVVDNVLFRMKLMAERQLGQNDQ 41 T L+EE+ KLEKL+S+ VKFLRL+ R S + DS+ VL+R+ L+A RQ G Q Sbjct: 137 TEINLSEEEKQKLEKLQSLRVKFLRLLQRLGHSAE-DSIAAQVLYRLALLAGRQAG---Q 192 Query: 40 LFDLNTAKLIALQ 2 LF L+ AK A++ Sbjct: 193 LFSLDAAKKKAVE 205