BLASTX nr result
ID: Cnidium21_contig00042970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00042970 (373 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279407.1| PREDICTED: probable WRKY transcription facto... 59 3e-07 ref|XP_002308538.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|NP_197989.2| putative WRKY transcription factor 50 [Arabidop... 59 4e-07 ref|XP_003522275.1| PREDICTED: probable WRKY transcription facto... 58 9e-07 emb|CAN73664.1| hypothetical protein VITISV_012139 [Vitis vinifera] 58 9e-07 >ref|XP_002279407.1| PREDICTED: probable WRKY transcription factor 50 [Vitis vinifera] gi|296081679|emb|CBI20684.3| unnamed protein product [Vitis vinifera] Length = 166 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +1 Query: 283 RIAIVTKSEVEIMDDGYKWRKYGKKMVKNS 372 R+A +TKSE+EI+DDG+KWRKYGKKMVKNS Sbjct: 91 RVAFITKSEIEILDDGFKWRKYGKKMVKNS 120 >ref|XP_002308538.1| predicted protein [Populus trichocarpa] gi|222854514|gb|EEE92061.1| predicted protein [Populus trichocarpa] Length = 165 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 283 RIAIVTKSEVEIMDDGYKWRKYGKKMVKNS 372 R+A TKSE+EI+DDGYKWRKYGKKMVKNS Sbjct: 92 RVAFKTKSEIEILDDGYKWRKYGKKMVKNS 121 >ref|NP_197989.2| putative WRKY transcription factor 50 [Arabidopsis thaliana] gi|29839580|sp|Q8VWQ5.1|WRK50_ARATH RecName: Full=Probable WRKY transcription factor 50; AltName: Full=WRKY DNA-binding protein 50 gi|18252117|gb|AAL61857.1| WRKY transcription factor 50 [Arabidopsis thaliana] gi|225898933|dbj|BAH30597.1| hypothetical protein [Arabidopsis thaliana] gi|332006149|gb|AED93532.1| putative WRKY transcription factor 50 [Arabidopsis thaliana] Length = 173 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +1 Query: 277 EGRIAIVTKSEVEIMDDGYKWRKYGKKMVKNS 372 +GR+A T+SEVE++DDG+KWRKYGKKMVKNS Sbjct: 98 KGRVAFKTRSEVEVLDDGFKWRKYGKKMVKNS 129 >ref|XP_003522275.1| PREDICTED: probable WRKY transcription factor 50-like [Glycine max] Length = 161 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 283 RIAIVTKSEVEIMDDGYKWRKYGKKMVKNS 372 R+A TKSEVEI+DDG+KWRKYGKKMVKNS Sbjct: 88 RVAFKTKSEVEILDDGFKWRKYGKKMVKNS 117 >emb|CAN73664.1| hypothetical protein VITISV_012139 [Vitis vinifera] Length = 166 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 283 RIAIVTKSEVEIMDDGYKWRKYGKKMVKNS 372 R+A TKSE+EI+DDG+KWRKYGKKMVKNS Sbjct: 91 RVAFXTKSEIEILDDGFKWRKYGKKMVKNS 120