BLASTX nr result
ID: Cnidium21_contig00042726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00042726 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278276.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 emb|CAN77580.1| hypothetical protein VITISV_015346 [Vitis vinifera] 62 6e-08 ref|XP_003555763.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 >ref|XP_002278276.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Vitis vinifera] Length = 307 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -3 Query: 292 GKEFFEVLKGKGFVVDEKEVREVLKGRRGPEFRGVMDILFGK 167 G+EF E +K KGF DEK VRE+LK RRG FR +MDILFGK Sbjct: 266 GREFLEQMKAKGFTPDEKAVREILKNRRGQVFRSIMDILFGK 307 >emb|CAN77580.1| hypothetical protein VITISV_015346 [Vitis vinifera] Length = 347 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -3 Query: 292 GKEFFEVLKGKGFVVDEKEVREVLKGRRGPEFRGVMDILFGK 167 G+EF E +K KGF DEK VRE+LK RRG FR +MDILFGK Sbjct: 306 GREFLEQMKAKGFTPDEKAVREILKNRRGQVFRSIMDILFGK 347 >ref|XP_003555763.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Glycine max] Length = 289 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -3 Query: 277 EVLKGKGFVVDEKEVREVLKGRRGPEFRGVMDILFGK 167 E +KGKGFV DEK VREVL +RGP FR V+D+LFGK Sbjct: 253 EQMKGKGFVPDEKAVREVLASKRGPVFRNVIDVLFGK 289