BLASTX nr result
ID: Cnidium21_contig00042524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00042524 (546 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525457.1| leucine-rich repeat containing protein, puta... 56 3e-06 ref|XP_002520787.1| leucine-rich repeat-containing protein 2, lr... 55 5e-06 ref|XP_003619313.1| Nucleotide binding site leucine-rich repeat ... 55 7e-06 emb|CBI35146.3| unnamed protein product [Vitis vinifera] 55 7e-06 ref|XP_002269685.1| PREDICTED: putative disease resistance RPP13... 55 7e-06 >ref|XP_002525457.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223535270|gb|EEF36947.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 1177 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/76 (36%), Positives = 41/76 (53%), Gaps = 1/76 (1%) Frame = +1 Query: 82 LYITDFGGLKXXXXXXXXXXXXXXXXIFNCENLESLPT-FDESHSLQQLSVFRCPILAER 258 L++ DF GL+ I++C NL SLP SL+ LS+++CP L +R Sbjct: 1041 LHLLDFPGLQTLPEWIENLKLLRELSIWDCPNLTSLPNAMQHLTSLEFLSIWKCPNLEKR 1100 Query: 259 CSKGSGPEWFKIQHIP 306 C K G +W KI+H+P Sbjct: 1101 CKKEEGEDWHKIKHVP 1116 >ref|XP_002520787.1| leucine-rich repeat-containing protein 2, lrrc2, putative [Ricinus communis] gi|223539918|gb|EEF41496.1| leucine-rich repeat-containing protein 2, lrrc2, putative [Ricinus communis] Length = 1164 Score = 55.5 bits (132), Expect = 5e-06 Identities = 33/82 (40%), Positives = 41/82 (50%), Gaps = 3/82 (3%) Frame = +1 Query: 70 ALSYLYITDFGGLKXXXXXXXXXXXXXXXXIFNCENLESLPTFDESHSLQQLS---VFRC 240 AL LYI++F + I NC LE LPT L +LS + C Sbjct: 1050 ALRDLYISEFHLMAALPEWLGYLSSLEHLNITNCWFLEYLPTATTMQRLSRLSKLEISAC 1109 Query: 241 PILAERCSKGSGPEWFKIQHIP 306 PIL++ C+KGSG EW KI HIP Sbjct: 1110 PILSKNCTKGSGSEWSKISHIP 1131 >ref|XP_003619313.1| Nucleotide binding site leucine-rich repeat disease resistance protein [Medicago truncatula] gi|355494328|gb|AES75531.1| Nucleotide binding site leucine-rich repeat disease resistance protein [Medicago truncatula] Length = 1083 Score = 55.1 bits (131), Expect = 7e-06 Identities = 30/81 (37%), Positives = 40/81 (49%), Gaps = 1/81 (1%) Frame = +1 Query: 67 PALSYLYITDFGGLKXXXXXXXXXXXXXXXXIFNCENLESLP-TFDESHSLQQLSVFRCP 243 P+L L + F L I+ NL+SLP F + +LQ LS+ RCP Sbjct: 951 PSLQKLSLYHFPSLTSLPDCLGAMTSLQVLDIYEFPNLKSLPDNFQQLQNLQYLSIGRCP 1010 Query: 244 ILAERCSKGSGPEWFKIQHIP 306 L +RC +G G +W KI HIP Sbjct: 1011 KLEKRCKRGKGEDWHKIAHIP 1031 >emb|CBI35146.3| unnamed protein product [Vitis vinifera] Length = 731 Score = 55.1 bits (131), Expect = 7e-06 Identities = 23/50 (46%), Positives = 32/50 (64%) Frame = +1 Query: 160 IFNCENLESLPTFDESHSLQQLSVFRCPILAERCSKGSGPEWFKIQHIPT 309 I+NC+ L+S P SL L ++RCP+L +RC + G EW KI HIP+ Sbjct: 429 IWNCDKLKSFPKQGLPASLSVLEIYRCPLLKKRCQRDKGKEWRKIAHIPS 478 >ref|XP_002269685.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Length = 1290 Score = 55.1 bits (131), Expect = 7e-06 Identities = 23/50 (46%), Positives = 32/50 (64%) Frame = +1 Query: 160 IFNCENLESLPTFDESHSLQQLSVFRCPILAERCSKGSGPEWFKIQHIPT 309 I+NC+ L+S P SL L ++RCP+L +RC + G EW KI HIP+ Sbjct: 1233 IWNCDKLKSFPKQGLPASLSVLEIYRCPLLKKRCQRDKGKEWRKIAHIPS 1282