BLASTX nr result
ID: Cnidium21_contig00042482
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00042482 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313416.1| predicted protein [Populus trichocarpa] gi|2... 73 3e-11 emb|CBI16054.3| unnamed protein product [Vitis vinifera] 72 6e-11 ref|XP_002280428.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_002520500.1| pentatricopeptide repeat-containing protein,... 69 5e-10 ref|XP_003552616.1| PREDICTED: pentatricopeptide repeat-containi... 68 7e-10 >ref|XP_002313416.1| predicted protein [Populus trichocarpa] gi|222849824|gb|EEE87371.1| predicted protein [Populus trichocarpa] Length = 650 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = +2 Query: 200 EPNPTQHTYELLILSCSRQNSLSDAGIVHRRLINDGFDQDPFL 328 EPNP QHTYELLILSC+ QNSL DA VHR L+ +GFDQDPFL Sbjct: 65 EPNPAQHTYELLILSCTHQNSLLDAQRVHRHLLENGFDQDPFL 107 >emb|CBI16054.3| unnamed protein product [Vitis vinifera] Length = 476 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = +2 Query: 197 KEPNPTQHTYELLILSCSRQNSLSDAGIVHRRLINDGFDQDPFL 328 +EPNPTQHTYELLILSC+RQNSL +HR LI+DG DQDPFL Sbjct: 72 QEPNPTQHTYELLILSCTRQNSLPQGIDLHRHLIHDGSDQDPFL 115 >ref|XP_002280428.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic [Vitis vinifera] Length = 658 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = +2 Query: 197 KEPNPTQHTYELLILSCSRQNSLSDAGIVHRRLINDGFDQDPFL 328 +EPNPTQHTYELLILSC+RQNSL +HR LI+DG DQDPFL Sbjct: 72 QEPNPTQHTYELLILSCTRQNSLPQGIDLHRHLIHDGSDQDPFL 115 >ref|XP_002520500.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540342|gb|EEF41913.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 414 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 200 EPNPTQHTYELLILSCSRQNSLSDAGIVHRRLINDGFDQDPFL 328 EP+P QHTYELL+LSC+ QNS DA VH+ L+++GFDQDPFL Sbjct: 66 EPDPAQHTYELLLLSCTHQNSFLDAQFVHQHLLDNGFDQDPFL 108 >ref|XP_003552616.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Glycine max] Length = 658 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +2 Query: 200 EPNPTQHTYELLILSCSRQNSLSDAGIVHRRLINDGFDQDPFL 328 EPNPTQ T+E LI SC++QNSLSD VHRRL++ GFDQDPFL Sbjct: 73 EPNPTQRTFEHLICSCAQQNSLSDGLDVHRRLVSSGFDQDPFL 115