BLASTX nr result
ID: Cnidium21_contig00042305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00042305 (420 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610808.1| Pentatricopeptide repeat-containing protein ... 57 2e-06 >ref|XP_003610808.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355512143|gb|AES93766.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1084 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/49 (51%), Positives = 36/49 (73%) Frame = -3 Query: 415 EISDFTSLIKGLIRMDRWEEALQLSHSLCCMDIKWIPSKNTNKSD*VCK 269 E+S LIKGLI++D+W+EALQLS S+C MDI W+ K T +++ + K Sbjct: 930 ELSILVHLIKGLIKVDKWQEALQLSDSICQMDIHWLQEKATGRTEEMVK 978