BLASTX nr result
ID: Cnidium21_contig00041856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00041856 (559 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537901.1| PREDICTED: endothelin-converting enzyme 2-li... 55 1e-05 >ref|XP_003537901.1| PREDICTED: endothelin-converting enzyme 2-like [Glycine max] Length = 248 Score = 54.7 bits (130), Expect = 1e-05 Identities = 20/34 (58%), Positives = 26/34 (76%) Frame = -2 Query: 549 PHFR*PVFGAPQFNWSLKWRSFGD*FHYVIYT*K 448 PHFR P+F AP FNWS++W +FG+ FHY +Y K Sbjct: 171 PHFRRPIFNAPDFNWSVEWTTFGETFHYFVYVLK 204