BLASTX nr result
ID: Cnidium21_contig00041853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00041853 (392 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138466.1| PREDICTED: BTB/POZ domain-containing protein... 54 1e-05 ref|XP_004138465.1| PREDICTED: BTB/POZ domain-containing protein... 54 1e-05 >ref|XP_004138466.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 2 [Cucumis sativus] gi|449495254|ref|XP_004159779.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Cucumis sativus] Length = 550 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 303 LNGAEEAALMELLNFMYSNTLSVTTAPALL 392 +N +EEAALMELLNFMYSN+LSVTTAPALL Sbjct: 183 INASEEAALMELLNFMYSNSLSVTTAPALL 212 >ref|XP_004138465.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 1 [Cucumis sativus] Length = 552 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 303 LNGAEEAALMELLNFMYSNTLSVTTAPALL 392 +N +EEAALMELLNFMYSN+LSVTTAPALL Sbjct: 185 INASEEAALMELLNFMYSNSLSVTTAPALL 214